NARROW RESULTS BY
Promotion
Category
- [-] Enzymes & Inhibitors (2786)
- 2-D Clean-Up Kits (3)
- 2D DIGE Labeling Dyes (1)
- 2D Gels (3)
- 2D Isoelectric Focusing (IEF) Gels (5)
- 2D Isoelectric Focusing (IEF) Instruments (14)
- 2D Sample Preparation (8)
- 2D, Storage (78)
- 2ND MESSENGERS-EIA (Enzyme Immunoassay) (1)
- 3-in-1: DNA, RNA, Protein (1)
- Abdominal (2)
- Ab Kits (11)
- Acids (10515)
- Acids & Caustics (4)
- Acrylamides (55)
- Adam Equipment (2)
- Adhesive Bandages (24)
- Adhesives (3)
- Administration Sets (1)
- Admissions / Bedside Items (13)
- Adsorbents (63)
- Adult Bibs and Smocks (8)
- Adult Wipes & Washcloths (18)
- Affinity Antibody Columns (55)
- Affinity Antibody Media (11)
- Affinity Other Columns (27)
- Affinity Other Media (76)
- Affinity Tag Columns (13)
- Affinity Tag Media (11)
- Agarose, Detection (8)
- Agarose, Electrophoresis, Detection (6)
- Agaroses (56)
- Agilent Compatible Tips (7)
- Air (69)
- Air Dusters & Aerosols (1)
- Albumins (106)
- Alcohol (3)
- Alcohol Dispensers (1)
- Alcohols, Cleaners (20)
- Alginate & Chitin Beads (4)
- Allergen Testing (33)
- All Plant (64)
- Aluminum Foil (11)
- American CleanStat (7)
- Amino Acids (273)
- Ampules (18)
- Anaerobic Systems (6)
- Analytical Balances (50)
- Analyzers & Accesories (3)
- Analyzers/Accessories (22)
- Anemometers (33)
- Anesthesia Equipment and Accessories (3)
- Aniline Point Apparatus (1)
- Animal Cell And Tissue Culture (6)
- Animal Handling (231)
- Antibiotics, Antimycotics & Preservatives (442)
- Antibodies (59503)
- Antibodies, Covid-19 Serological Detection ELISA (12)
- Anti-Fatigue Floor Mats (6)
- Anti-Foam Sprays (2)
- Anti-Static Bags (28)
- Anti-Static Chair Covers (1)
- Anti-Static Latex Finger Cots (4)
- Apparel (687)
- Apparel, Covid-19 PPE (4)
- Apparel & Glove Dispensers (11)
- Applicators (92)
- Applicator Sticks (2)
- Aprons, Disposable (26)
- Armboards (1)
- Arsenic Analysis (4)
- Aspirating Pumps / Accessories (6)
- Assay Kits (1570)
- Assembly Sets (2)
- Atago (105)
- Autoclaves (38)
- Autoclaves / Sterilizer (1)
- Autoclave Tape & Bag (1)
- Automated Sealers, Amplification (9)
- Automatic Dispensers (6)
- Autoradiography Film (11)
- Bacon Bomb (Oil Sampling) (2)
- Bacterial Plasmid (5)
- Bacterial Vaginosis (2)
- Badges, Covid-19 Employee Re-Entry Supplies (2)
- Bags (192)
- Bags, Sample Collection (20)
- Balance Accessories (111)
- Barometers (10)
- Bar Soap (2)
- Basins / Bowls (2)
- Baths (271)
- Batteries (22)
- Batteries, Lab (4)
- BD (11)
- Beakers (133)
- Beakers, Glass (7)
- Beakers, Plastic (5)
- Beard Covers, Disposable (9)
- Beckman Compatible Tips (18)
- Bed Linens (3)
- Bell Jars (6)
- Bench Protectors (28)
- Biohazard Can Liners & Bags (1)
- bioLAM (Lectin Affinity Matrix) (3)
- Biologically Active Small Molecules (6493)
- Biosensors (2)
- bioSilica Matrix (1)
- BioWorld (1)
- Blades (1)
- Bleach, Cleaners (30)
- Blenders (51)
- Blood And Bodily Fluids (2)
- Blood Collection (53)
- Blood Collection Holders and Adapters (2)
- Blood Collection Needles (1)
- Blood Collection Sets (1)
- Blood Dispensers, Covid-19 LF Detection (1)
- Blood Draw (4)
- Blood Pressure (11)
- Blood Pressure Replacement Parts (1)
- Blot Detecting (1)
- Blunt Tips & Needles (47)
- Boats, Combustion (4)
- BOD Analysis (8)
- Boilers (1)
- Boiling Stones (13)
- Books (6)
- Boots & Bootcovers, Disposable (15)
- Boots & Bootcovers, Sterile (3)
- Boots, Reusable (1)
- Bottles (1557)
- Bottles & Jars, Glass (23)
- Bottles & Jars, Plastic (12)
- Bottles, Virology (2)
- Bottle Top Filters, Virology (2)
- Bouffant Cap Dispensers (1)
- Bouffant Caps, Disposable (22)
- Bowls (6)
- Boxes (74)
- Boxes, Storage (26)
- Brushes (72)
- Brushes & Brooms, Cleanroom (2)
- Brushes & Brooms, Janitorial (31)
- Buckets & Wringers, Cleanroom (28)
- Buckets & Wringers, Janitorial (2)
- Buffers (1894)
- Buffers, pH & Other (7)
- Bulk Transport Media, Covid-19 Sample Collection (3)
- Burets (82)
- Burners (55)
- BZK (1)
- Cabinets, Safety (28)
- Cabinets - Storage & Chemical (4)
- Calipers (7)
- Canes & Replacement Parts (1)
- Cans (11)
- Capes (13)
- Caps & Lids, Glass (1)
- Caps & Lids, Plastic (1)
- Carboys (168)
- Cart & Bowl Covers (3)
- Carts (114)
- Carts & Dollies (26)
- Casework (60)
- Casting Tapes / Splints (7)
- catgen test (1)
- cDNA & Cloning (24)
- CE and CE/MS (82)
- Cell ProlifeRation (4)
- Cell Scrapers (16)
- Cell Separation (39)
- Cellware, Tissue Culture (9)
- Centrifugal Concentrators (13)
- Centrifuges (406)
- Centrifuge Tubes, Plastic (1)
- Chairs (2460)
- Chambers (85)
- Chambers, Virology (4)
- Chaotropic Agents (9)
- Charts (10)
- Chelating Agents (30)
- Chemical Resistant (3)
- Chemical Resistant Gloves (9)
- Chemicals, Extraction Kits (11)
- Chemical Storage (76)
- Chemical Test Kits (83)
- Chemistry Analyzers (2)
- Chemistry Kits (407)
- Chillers, Collection (11)
- Chlamydia (1)
- Chromatography (3)
- Chromatography Reagents (9682)
- Circulating DNA (2)
- Clamps/Supports (363)
- Clean Bench (8)
- Cleaners (369)
- Cleaners, Covid-19 Disinfectants and Sanitizers (4)
- Cleaners, Lab (6)
- Cleaner & Soap Dispensers (4)
- Cleanroom Bagged Latex Gloves (10)
- Cleanroom Bags (45)
- Cleanroom Bond Paper (25)
- Cleanroom Chairs (37)
- Cleanroom / ESD Chairs (2)
- Cleanroom Laminate Top (Non-ESD) (1)
- Cleanroom Nylon (4)
- Cleanroom Polyethylene (11)
- Cleanroom Racks (12)
- Cleanroom Surface Cleaners (6)
- Cleanroom Tape (44)
- Cleanroom Vacuums (10)
- Cleanroom Wipers - Dry (98)
- Cleanroom Wipers - Presaturated (21)
- Cleanroom Wipers - Sterile (9)
- Cleansers (5)
- Clean Up Kits, Extraction (3)
- Clinical Coats / Jackets (9)
- Clinical Coveralls (3)
- Clinical Eyewear (5)
- Clinical First Aid Kits (2)
- Clinical Gowns (39)
- Clinical Head / Face (19)
- Clinical Masks (72)
- Clinical Mats (1)
- Clinical Measures (1)
- Clinical Miscellaneous Products (1)
- Clinical Packaging Tape (2)
- Clinical Respirator Masks (6)
- Clinical Scrub / OR (19)
- Clinical Shoe Covers (11)
- Clinical Timers (2)
- Clippers (1)
- Clocks (10)
- Cloning and Expression (14)
- Closure Strips (10)
- Coagulation Analyzers (3)
- Coated Knit Gloves (11)
- Coated Microplates (17)
- Cohesive (10)
- Collection, Covid-19 LF Detection (1)
- Collection Cups & Containers (5)
- Colorimeter Reagent Kits (4)
- Colorimeters (83)
- Column accessories (8)
- Columns (9210)
- Columns, Prepared (4)
- Compression (4)
- Concentration, Desalting, and Other Cleanup (17)
- Concentrators / Humdifiers (2)
- Condensers (183)
- Conductivity (4)
- Connectors / Accessories (1)
- Connectors/Plugs/Pins (4)
- Containers (289)
- Containers, Plastic (6)
- Controlled Environment (3)
- Copolymer Gloves (15)
- Corks (11)
- Corning cellgro Medium (2)
- Cotton (3)
- Cotton Balls / Cotton Rolls (8)
- Cotton - Inspection (7)
- Cotton-Tipped / Dry (11)
- Cotton Tipped Swabs (29)
- Cotton-Tipped / Wet (5)
- Counters (60)
- Coveralls, Disposable (71)
- Coveralls, Reusable (8)
- Coveralls, Sterile (15)
- COVID Proteins, Covid-19 Serological Detection ELISA (2)
- CPR Resuscitators (1)
- Crash Kits (1)
- Crimpers / Decappers (31)
- Crucibles (57)
- Crushers (1)
- Crutches & Replacement Parts (1)
- CSR Wrap (11)
- Cultured Cells and Tissue (2)
- Cups (54)
- Cups / Jars (5)
- Cut-Resistant Gloves (1)
- Cutting Tools (21)
- Cyanoacrylates (1)
- CyDye Protein Labeling (12)
- Cylinders (127)
- Cylinders, Glass (6)
- Cylinders Regulators (5)
- Data Loggers (97)
- Decappers, Storage (10)
- Deep Well Plates, Automation & Robotics (7)
- Deep Well Plates, Extraction (10)
- Degassers, HPLC (3)
- Dental Sponges (2)
- Deodorizers (1)
- Desiccants (37)
- Desiccants & Indicators (4)
- Desiccators (87)
- Desktop Charging Stations (2)
- Detergents (270)
- Diabetes Glucose Monitors (2)
- Dialysis Tubing (42)
- Digestion / Distillation (19)
- Digital X-Ray Accessories (3)
- Disaster Preparedness (1)
- Dishes (255)
- Dishes, Glass (2)
- Disinfectants (17)
- Disinfectants & Germicides (4)
- Disks, SPE (4)
- Dispensers (100)
- Dispensers, Covid-19 Employee Re-Entry Supplies (2)
- Dispensing Hardware (1)
- Disposable Respirators (25)
- Distillation, Petroleum (3)
- DI Water, H20 and Distilled (3)
- DNA (245)
- DNA, Extraction Kits (44)
- DNA Modification Enzymes (17)
- DNA/RNA Cleanup (1)
- DNA/RNA Hybridization (2)
- dNTP, Amplification (10)
- dNTPs & Nucleotides (5)
- Dopplers - Equipment (26)
- Drape Sheets (20)
- Dressings (208)
- Dressings / Kits (4)
- Drugs of Abuse (1)
- Drum Trucks (62)
- Dry Block Heaters & Chillers, Automation & Robotics (4)
- Dry Box Gloves (1)
- Dye Labeled Nucleic Acids (2)
- Dyes & Stains, Electrophoresis, Detection (13)
- Dynalon (30)
- Dynamic Devices Compatible Tips (2)
- Ear Muffs (10)
- Earplug Stations (14)
- Ear Protection (39)
- ECF Detection Reagents (21)
- ECG Accessories (2)
- Ecoli (31)
- E. coli, Extraction Kits (3)
- Education, Biology (120)
- Education, Physics (535)
- Education, Prepared Slides (352)
- EICOSANOIDS-EIA (Enzyme Immunoassay) (64)
- Elastic (14)
- Electrical (163)
- Electrodes (362)
- Electrodes / Pads (11)
- Electrophoresis (168)
- Electrophoresis, Detection (4)
- Electrophoresis, RNA (3)
- Electroporation (2)
- Electrosurgery Cautery and Tips (1)
- ELISA Kits (18645)
- ELISA Kits, Covid-19 Serological Detection ELISA (8)
- Embedding Rings, Histology (1)
- Emergency Eyewash Stations & Showers (9)
- Emergency Response (38)
- Empty Columns (9)
- EMS Instruments / Equipment (1)
- Enclosures (23)
- Endoscopy Scopes (3)
- Envelopes (1)
- Enzyme Detection (1)
- Enzymes, Extraction Kits (1)
- Epigenetics, Extraction Kits (82)
- Eppendorf (33)
- Eppendorf Compatible Tips (1)
- Equipment (6)
- Equipment Covers (4)
- ESD Apparel & Garments (7)
- ESD Cleaners (2)
- ESD Conductive Containers & Boxes (5)
- ESD Floor Finishes (1)
- ESD Floor Mats (5)
- ESD Gloves & Finger Cots (1)
- ESD Grounding Accessories (1)
- ESD Grounding Cords & Monitors (4)
- ESD Heel Grounders (3)
- ESD Ionizers (4)
- ESD Knit - Coated Gloves (2)
- ESD Meters & Testers (3)
- ESD Moisture Barrier Bags (3)
- ESD Packaging Labels (2)
- ESD Safe Benches (3)
- ESD-Safe Chairs (1)
- ESD-Safe Rubber Bands (3)
- ESD Safe Swabs (1)
- ESD Solutions, Cleaners & Sprays (7)
- ESD Spray Bottles (2)
- ESD Static Control Tape (7)
- ESD Swabs & Applicators (9)
- ESD Table Mat Accessories (2)
- ESD Table Mats (8)
- ESD Tapes (3)
- ESD Tools & Consumables (11)
- ESD Tweezers & Tools (6)
- ESD Wash Bottles (1)
- ESD Wipers & Wafer Separators (3)
- ESD Work Brushes (2)
- ESD Wrist Strap Grounders (8)
- Ethanol-IPA, Covid-19 (5)
- Ethanol & Methyl Alcohol (15)
- Evacuation (1)
- Evaporators (170)
- Exam (1)
- Examination Gloves (1)
- Exam Room Paper Towels (33)
- Extension Sets (6)
- Extraction (89)
- Eye (6)
- Eye & Face Protection (34)
- Eye Protection (1)
- Eye Wash Stations (68)
- Eyewash Stations & Solutions (10)
- Face Masks, Covid-19 Employee Re-Entry Supplies (2)
- Face Masks, Covid-19 PPE (3)
- Facemasks, Disposable (42)
- Face Shields (28)
- Facility, Floor & Lab Cleaners (22)
- Fecal Occult Blood (7)
- Feeding Tubes (13)
- Film (10)
- Filter Disks & Cartridges (21)
- Filtered Pipet Tips, Liquid Handling (11)
- Filter Plates, Extraction (13)
- Filters (1440)
- Filters, Extraction Kits (2)
- Filters - Paper, Disc and Capsule, Lab (8)
- Filter Systems, HPLC (2)
- Fire Extinguishers (21)
- First Aid (44)
- First Aid Kits & Stations (13)
- Fixatives (1)
- Flashlights (7)
- Flash Point Testers (7)
- Flasks (853)
- Flasks, Virology (18)
- Floss Accessories (1)
- Flow Cytometry, Serology (1)
- Flux Dispensers (2)
- Foam Earplugs (4)
- Foam Hand Sanitizers (14)
- Foam Handwash (2)
- Foam Soap (29)
- Foam Tipped Swabs (74)
- Foil (366)
- Foil - Aluminum, Lab (1)
- Food Service (1)
- Food Service Cups (1)
- Foot & Hand Care (2)
- Foot Protection (2)
- Force Gages (14)
- Forceps (84)
- Forensics (42)
- Freeze Dryers (51)
- Freezer Racks, Sample Management (10)
- Freezers (107)
- Frocks, Disposable (37)
- Frocks, Reusable (13)
- Fume Hoods, Enclosures, and Biosafety Cabinets (65)
- Funnels (385)
- Furnaces (84)
- Gas Chromatography (777)
- Gas Equipment (30)
- GC Instruments, Parts and Supplies (1048)
- GC/MS Instruments, Parts and Supplies (102)
- Gel Casting & Staining (21)
- Gel Extraction (1)
- Gel Filtration Columns (20)
- Gel Filtration Media (33)
- Gelling Agents (1)
- Gel Pipet Tips, Liquid Handling (10)
- Gel Red & Gel Green, Detection (4)
- Gels & Liquid Sanitizers (29)
- General (137)
- General Chromatography (2426)
- General Lab Products (2)
- General / Miscellaneous Surgery Instruments (3)
- General / OR (10)
- General Purpose Bags (35)
- General Supplies, Histology (1)
- General Surgery Clamps and Hemostats (1)
- General Surgery Forceps (9)
- General Surgery Needle Holders (1)
- General Surgery Scissors (2)
- Genomic DNA (64)
- Genomics DNA Amplification (8)
- Glass (839)
- Glasses (67)
- Glassware (60)
- Glove Boxes (63)
- Glove Dispensers (13)
- Glove Dispensers / Holders (12)
- Glove Liners (14)
- Gloves (2)
- Glucose-A1C Analyzers (6)
- Glucose-A1C Controls and Calibrators (1)
- Glutaraldehyde (4)
- Goggles (35)
- Goggles/Glasses/Shields (4)
- Gowning Benches & Racks (15)
- Gowns (23)
- Gowns, Disposable (12)
- Gowns, Sterile (1)
- Gravity Columns (1)
- Gravity Convection Ovens (17)
- Grease Workers (7)
- Grinders (76)
- Grooming (10)
- Grounding - Mats, Straps & Cords (45)
- Growth Factors (5)
- GST Tag Small Scale (13)
- GYN Biopsy (2)
- GYN Forceps (1)
- GYN General and Miscellaneous (1)
- GYN Speculum (2)
- Hamilton Compatible Tips (8)
- Hand Cleaners, Lotions & Soaps (26)
- Hand Dispensers (4)
- Hand Protection (191)
- Hand Sanitizer, Covid-19 Disinfectants and Sanitizers (6)
- Hand Sanitizer Dispensers (25)
- Hand Sanitizers (7)
- Hand Sanitizers, Covid-19 Employee Re-Entry Supplies (1)
- Hand & Skin Care (86)
- Hand Wipes (3)
- Hard Hat Accessories (3)
- Hard Hats (10)
- Harnesses (28)
- Hazardous Material Packaging (2)
- Hazmat Bags, Lab Disposal (1)
- Head and Neck (1)
- Head and Neck Splints and Braces (1)
- Headrest Covers (11)
- Health & Beauty (1)
- Hearing Protection - Ear Plugs (2)
- Heaters (57)
- Heat Guns (8)
- Heating/Cooling Blocks (78)
- Heating Tapes (33)
- Heat Sealers/Seals, Covid-19 Molecular Detection RT-PCR (1)
- Hematology Analyzer Accessories (1)
- Hematology Controls and Calibrators (1)
- Herbicides (4)
- Heterobifunctional Reagents (20)
- HIC Columns (26)
- HIC Media (14)
- HiMedia (507)
- His Tag Small Scale (14)
- Histology (229)
- HIV (2)
- Hobby Blades (2)
- Homobifunctional Reagents (11)
- Homogenizers (136)
- Honeywell Safety Products (47)
- Hoods (149)
- Hoods, Disposable (15)
- Hoods, Reusable (5)
- Hoods, Sterile (2)
- Hot Plates (102)
- Hot Plates and Stirrers (1)
- HPLC (2046)
- HPLC Systems (3)
- H. Pylori (7)
- Hybridization Ovens (25)
- Hydrometers (98)
- Hygrometers (47)
- Hypothermia Blankets (6)
- Ice Buckets, Collection (4)
- Ice Makers (82)
- ICP-MS (932)
- IEX Columns (56)
- IEX Media (34)
- Igniters, Combustion (1)
- Illuminator Bulbs & Lamps (1)
- Illuminator Penlights (1)
- Illuminator Vaginal Specula (2)
- Illumnator Batteries (1)
- Imhoff Cones (7)
- Immunoassay Accessories (1)
- Immunology, Serology (3)
- Incontinence Briefs (1)
- Incubators (167)
- Indicators (297)
- Indicators Cryogenic (7)
- Industrial Soap (1)
- Industrial Tapes (6)
- Industrial Wipes (4)
- Industrial Work Gloves (2)
- Influenza (19)
- Inoculating (58)
- Instruments (108)
- Instruments, Covid-19 Molecular Detection RT-PCR (2)
- Irrigation (2)
- Irrigation and Flush Solutions (1)
- Isolation & Purification (84)
- IV Solutions (1)
- IV Specialty Sets (1)
- IV Stopcocks (3)
- Jackets, Reusable (2)
- Jars (122)
- JG Finneran (1)
- Kapton Tapes (7)
- Karl Fischer (117)
- KingFisher Supplies, Covid-19 Sample Extraction (4)
- Kits (18)
- Kits, RT-PCR, Detection (3)
- Kjeldahl, Fat and Crude Fiber Apparatus (11)
- Kneeling Mats (4)
- Knit Work Gloves (1)
- Knives (3)
- Knives and Cutters (21)
- Kraft Paper (1)
- Labcoats, Disposable (48)
- Labcoats, Reusable (8)
- Labeling Systems & Labels (1)
- Labels (323)
- Labels, Collection (36)
- Labels, Sample Management (27)
- Labomed (1)
- Laboratory Exam Gloves (402)
- Laboratory Safety (24)
- Laboratory Wipers (94)
- Laboratory Wipers, Lab (15)
- Ladders (3)
- Ladders, Detection (4)
- Lamps (493)
- Lancets and Blades (11)
- Lancets, Covid-19 LF Detection (2)
- Lanyards (11)
- Laparotomy (2)
- Large Format Vertical Gel Systems (7)
- Large Volume Pipet Tips, Liquid Handling (5)
- Lasers and Light Pens (1)
- Latex Finger Cots (5)
- Latex Finger Tape (1)
- Latex Powder-Free Exam Gloves, Clinical (10)
- Laundry Carts (1)
- Leakage Detectors (3)
- Leather Work Gloves (7)
- Lens Cleaners (4)
- Lens Papers (11)
- LFIA-POC Finger Stick Test Kits, Covid-19 LF Detection (3)
- Lids, Automation & Robotics (2)
- Lifelines (8)
- Lifters and Scrapers, Virology (2)
- Lifts / Slings (1)
- Linens (1)
- Liners, Glove (13)
- Liners - Table & Bench Paper, Lab (1)
- Liquid Nitrogen Monitors (1)
- Liquid Soap (23)
- Lockout/Tagout (28)
- Loops and Spreaders, Virology (4)
- Lower Extremities (7)
- Lower Extremities Splints and Braces (17)
- Lubricants (8)
- Lubricating / Utrasound Gel (4)
- Magnetic Bead Kits (16)
- Magnetic Bead Purification (22)
- Magnetic Beads (18)
- Magnetic Beads, Extraction (50)
- Magnetic Field Testers (7)
- Magnetic Plates, Automation & Robotics (12)
- Magnetic Plates, Covid-19 Molecular Detection RT-PCR (1)
- Magnifiers (18)
- Mailers (67)
- Manifolds, Vacuum/Gas (56)
- Mantles, Heating (61)
- Manual Dispensers (7)
- Markers, Cryogenic (7)
- Masks (3)
- Mastermix, Amplification (10)
- Matrix (1)
- Mats (88)
- Mattresses (2)
- Mayo/Instrument (1)
- Mechanical Balances (13)
- Mechanical Convection Ovens (35)
- Mechanics Gloves (2)
- Media (5138)
- Media and Reagents, Virology (11)
- Media & Components (236)
- Medical Equipment (13)
- Melting Point Apparatus (23)
- Membrane Filtration Media (107)
- Membranes (25)
- Mercury Analyzers (16)
- Metal Complexes (1391)
- Meters (695)
- Micro and Semi-Micro Balances (12)
- Microbiological Analysis, Dilution (2)
- Microbiomics, Extraction Kits (2)
- Microcentrifuge Tubes, Extraction (33)
- Microplates, Histology (1)
- Microscope Bulbs (8)
- Microscope Cover Glass (22)
- Microscope Coverslips (1)
- Microscopes (475)
- Microscopes & Accessories (1)
- Microscope Slides (196)
- Microscope Slides, Histology (10)
- Microscopy (67)
- Microtomes (5)
- Microwave Ovens (3)
- Milk Testing (8)
- Mills (69)
- Minor Procedure Trays (1)
- Misc. DOE (84)
- Miscellaneous (1284)
- Miscellaneous Analyzers, Reagents, and Tests (1)
- Miscellaneous Bath and Shower Aids (3)
- Miscellaneous Cardiology Supplies (3)
- Miscellaneous Dental (1)
- Miscellaneous Diagnostic Instruments (1)
- Miscellaneous Food Service (3)
- Miscellaneous Furniture (2)
- Miscellaneous Gloves (50)
- Miscellaneous GP Instruments (1)
- Miscellaneous Measurement Devices (2)
- Miscellaneous Patient Stuff (8)
- Miscellaneous Products (35)
- Miscellaneous Protein Sample Prep (44)
- Miscellaneous Sample Collection and Processing (1)
- Miscellaneous Special (2)
- Miscellaneous Storage (4)
- Miscellaneous Straps (1)
- Miscellaneous Stretchers (1)
- Miscellaneous Tubes and Airways (1)
- Miscellaneous XUSA (1)
- Misc. RZP (1)
- Misc SAMPLES (1)
- Misc. XCOL (2)
- Misc XGLT (1)
- misc. XIDT (1)
- misc. XIVF (1)
- Misc XNOV (1)
- Misc XSAL (1)
- Misc. XSXT (1)
- Misc. XVAL (5)
- misc. XVRS (1)
- Mixtures, Inorganic (1)
- mmP-ELISAs & Activity Assays (2)
- Moisture Balances (19)
- Moisture Barrier Bags (4)
- Moisture Determination (36)
- Molecular Devices Compatible Tips (2)
- Molecular Diagnostics RT-PCR, Covid-19 Sample Detection (3)
- Mononucleosis (4)
- Mop Handles & Hardware, Cleanroom (10)
- Mop Head Covers, Cleanroom (13)
- Mop Heads, Cleanroom (33)
- Mops & Handles, Janitorial (15)
- Mops & Mop Systems, Cleanroom (63)
- Mortar and Pestles (27)
- Multimeters (37)
- Multimodal media (15)
- MultiPhor Instruments (24)
- Multiphor Precast Gels (7)
- Multi-Use Dispensers (12)
- Mutiwell Plates, Automation & Robotics (59)
- NCI (2)
- Nebulizers / Compressors (1)
- Nebulizer Supplies (74)
- Needle Removal and Disposal (2)
- Needles (42)
- Net (3)
- NEW! Organic Synthesis (4705)
- NEW! Synthetica (341)
- NHS (1)
- Nitrile Finger Cots (3)
- Nitrile / Synthetic Exam / Non-Sterile (37)
- Non-Sterile (17)
- Non-Woven Wipers (2)
- Notebooks & Spiral Binders (22)
- Nucleases & Proteases (4)
- Nucleic Acid Analysis (283)
- Nucleic Acid Blotting Equipment (1)
- Nucleic Acid Blotting Membranes (6)
- Nucleic Acid Electrophoresis Equipment (2)
- Nucleic Acid Labeling Kits (13)
- Nucleic Acid Purification (13)
- Nucleotides, Analogs & Precursors (222)
- Nylon Gloves (10)
- Obsolete (3)
- Odor Eliminators (1)
- Office Supplies (83)
- Ointments, Creams, Lotions, and Gels (9)
- OPA (1)
- Oral (1)
- Oral Care (11)
- OR Equipment (8)
- Organic Reagents (3457)
- Organizers (46)
- Orthodontic Products (1)
- Other (6)
- Other, Histology (4)
- Other Meters & Monitors (1)
- Overbed (1)
- Oxygen (5)
- Packaging Labels (8)
- Packs (15)
- Pails (17)
- Pain Management (1)
- Paint Testing, Physical (24)
- Pants & Shirts, Disposable (2)
- Paper Charts (1)
- Paper Wipers (1)
- Paper Wipes, Rags & Towels, Janitorial (7)
- Patient Blankets / Linens (2)
- Patient Thermometers (9)
- PCR Cleanup (3)
- PCR Purification (35)
- Pens & Markers (6)
- Percussion Hammers (1)
- Perineal Products (16)
- Perkin Elmer Compatible Tips (9)
- Personal Barrier Protection, Covid-19 Employee Re-Entry Supplies (1)
- Personal Hygeine (47)
- Petri Dishes, Glass (4)
- Petri Dishes, Microbiology (1)
- Petri Dishes, Plastic (3)
- Phenolic Resin Top (Chemical) (1)
- Phenols (75)
- Photographic Film (1)
- pH Test Strips (92)
- Physical Therapy (1)
- Pill Crushers (2)
- Pill Envelopes (2)
- Pill / Medicine Containers (2)
- Pillowcases (8)
- Pillows (1)
- Pipet Fillers and Controllers, Virology (3)
- Pipets (334)
- Pipets, Glass (3)
- Pipets - Serological, Plastic (1)
- Pipets - Transfer, Plastic (10)
- Pipette Pumps, Lab Instruments (8)
- Pipetting (2)
- Pipet Tip Refill Systems, Liquid Handling (5)
- Pipet Tips, Liquid Handling (108)
- Pipettors (375)
- Pipettors, Lab Instruments (5)
- Pipettors, Liquid Handling (37)
- Pipettor Stands, Liquid Handling (5)
- Pipettor Tips (558)
- Piston & Wipers (2)
- Pitchers (17)
- Plain (4)
- Plant And Fungal (2)
- Plasmid, Extraction Kits (22)
- Plasmid Prep (41)
- Plastic Coverings (4)
- Plate Readers and Washers, Covid-19 Serological Detection ELISA (2)
- Platers (2)
- Plates (812)
- Plates, Amplification (73)
- Plates and Seals, Covid-19 Serological Detection ELISA (2)
- Plates, Covid-19 Molecular Detection RT-PCR (5)
- Plate Sealing, Amplification (29)
- Plate Sealing, Automation & Robotics (51)
- Plates, Extraction Kits (7)
- Plates, Virology (32)
- Platform Balances (8)
- Podiatry Nail Trimmers (1)
- Polyester Gloves (3)
- Polyester Tipped Swabs (14)
- Polymers (102)
- Positioners / Cushions (6)
- Positioning Aids (5)
- Posters (5)
- Post-It Pads (3)
- Post-Op (2)
- Pouches (5)
- Powdered Sterile Gloves, Clinical (1)
- Powder Free Boxed Latex Gloves (34)
- Powder Free Boxed Nitrile Gloves (112)
- Powder Free Cleanroom Nitrile Gloves (34)
- Powder-Free Sterile Gloves, Clinical (16)
- Power Supplies (3)
- Power Supplies, Electrophoresis (9)
- Pregnancy (HcG) (15)
- Pre-Saturated Wipers, Covid-19 Employee Re-Entry Supplies (2)
- Presses (62)
- Pressure Systems & Pads (4)
- Primary Monoclonal (189)
- Primary Polyclonal (413)
- Primers (1)
- Printers, Collection (11)
- Probe Purification (2)
- Probes & Primers, Covid-19 Molecular Detection RT-PCR (1)
- Procedure-IV (4)
- Products Not Found (2)
- Protective Bedding Covers (2)
- Protein (5709)
- Protein A/G (8)
- Protein Analysis (70)
- Protein Array, Covid-19 Serological Detection ELISA (1)
- Protein Blotting Consumables (120)
- Protein Blotting Instruments (6)
- Protein Detection (4)
- Protein Extraction (17)
- Protein, Extraction Kits (1)
- Protein Gels, Detection (7)
- Protein Purification (33)
- Protein Vertical Electrophoresis (20)
- Proteomics (222)
- Pulse Oximeter Accessories (3)
- Pulse Oximetry (9)
- Pumps (384)
- Pumps / Accessories (1)
- Pump Solvent Dispensers (7)
- Purification & Additives (94)
- Purification Supplies, Covid-19 Molecular Detection RT-PCR (1)
- Purified (16)
- Qiagen Compatible Tips (4)
- Racks (947)
- Racks, Automation and Robotics (2)
- Racks, Collection (14)
- Racks, Extraction (16)
- Racks, Storage (10)
- Radiation Protection (18)
- RAPD (1)
- Rare Earth Compounds (311)
- Razor Blades (21)
- Reaction Vessels (141)
- Readers (31)
- Reagents (2434)
- Reagents, 0 through 9 (4143)
- Reagents, A (16826)
- Reagents, B (11182)
- Reagents/Buffers (3)
- Reagents, C (11481)
- Reagents & Chemicals (2)
- Reagents, Covid-19 Sample Collection (2)
- Reagents, D (11539)
- Reagents, E (4632)
- Reagents, Electrophoresis, Detection (7)
- Reagents, F (4399)
- Reagents, G (2517)
- Reagents, H (5098)
- Reagents, I (3236)
- Reagents, J (142)
- Reagents, K (355)
- Reagents & Kits, Amplification (13)
- Reagents, L (3612)
- Reagents, M (14341)
- Reagents & Media (103)
- Reagents, N (6531)
- Reagents, O (1753)
- Reagents, P (11244)
- Reagents, Q (257)
- Reagents, R (2120)
- Reagents, S (7458)
- Reagents, T (9515)
- Reagents, U (480)
- Reagents, V (720)
- Reagents, W (243)
- Reagents, X (199)
- Reagents, Y (316)
- Reagents, Z (994)
- Recombinant Proteins (388)
- Recorders (20)
- Reducing Agents (14)
- Refractometers (108)
- Refrigerators / Freezers (212)
- Replacement Parts (14)
- Reservoirs, Automation & Robotics (4)
- Reservoirs, Liquid Handling (14)
- Reservoirs, Reagent (46)
- Resins, Chromatography (2)
- Respirators (106)
- Reusable Respirators (17)
- Rings (29)
- RNA (18)
- RNA/DNA Isolation (27)
- RNA, Extraction Kits (39)
- Roller Bottle Apparatus (9)
- Roller Extension Shafts (1)
- Room Dividers (2)
- RSV (1)
- RT-PCR, Detection (2)
- RT-PCR Detection, Covid-19 Molecular Detection RT-PCR (11)
- Safety (5)
- Safety Apparel (8)
- Safety Cabinets (29)
- Safety Cans (1)
- Safety Catheters (5)
- Safety Eyewash Stations (6)
- Safety Face Shields (10)
- Safety Glasses (25)
- Safety Goggles (8)
- Safety Guards & Protectors (27)
- Safety Hard Hats (5)
- Safety Lock-Out Tag-Out (20)
- Saline Collection, Covid-19 Sample Collection (5)
- Saliva Collection, Covid-19 Sample Collection (7)
- Salts (2878)
- Salts and Dry Chemicals (2)
- Sample Collection Cups and Collectors (2)
- Sample Collection & Preservation, Extraction Kits (6)
- Sample Collection Swabs and Brushes (11)
- Sample Preparation, Chromatography (131)
- Samplers (967)
- Scales (47)
- Scanners, Storage (17)
- Scissors (23)
- Scissors, Hand Tools (8)
- Scoops (36)
- Scribes, Lab Instruments (1)
- Scrub Pads (3)
- Scrub Pads, Cleanroom (1)
- Scrubs, Disposable (6)
- Sealing Film (107)
- Secondary Antibodies (12)
- Separopore® (53)
- Septa (92)
- Sequencing (10)
- Sequencing Cleanup (1)
- Sequencing Template Amplification (72)
- Sera (499)
- Serological Pipets, Liquid Handling (9)
- Serological Pipets, Virology (7)
- Services (2)
- Settlometers (2)
- Shakers (387)
- Sharps Containers (1)
- Sharps Containers, Lab (2)
- Sharps / Waste Containers (1)
- Shears (2)
- Shelving (23)
- Shielding Bags (13)
- Shields, Radiation (1)
- Shippers (36)
- Shoe Cover Dispensers (2)
- Shoecovers, Disposable (77)
- Shoecovers, Reusable (6)
- Shop Travelers (1)
- Shorts / Underwear (5)
- Shrink & Bubble Wrap (6)
- Sieves (136)
- Sigma-Aldrich (10843)
- Signage, Covid-19 Employee Re-Entry Supplies (1)
- Signs (23)
- Signs and Labels (201)
- Silica, Columns, and 96 Well Plates, Covid-19 Molecular Detection RT-PCR (2)
- Skin Closure Staples (3)
- Skin Closure Sutures (5)
- Sleeves (7)
- Sleeves & Sleevecovers, Disposable (23)
- Sleeves, Sterile (1)
- Slide Boxes, Histology (7)
- Slides & Covers, Lab (1)
- Slides, Virology (1)
- Smocks, Disposable (1)
- Smocks, Reusable (5)
- Soap Dispensers (15)
- Soft Goods (2)
- Soil, Stool And Water (2)
- Soil Test Kits (17)
- Solutions (12)
- Solutions, A (598)
- Solutions, B (429)
- Solutions, C (625)
- Solutions, D (272)
- Solutions, E (245)
- Solutions, F (217)
- Solutions, G (144)
- Solutions, H (353)
- Solutions, I (193)
- Solutions J (6)
- Solutions, K (25)
- Solutions, L (153)
- Solutions, M (480)
- Solutions, N (193)
- Solutions, O (43)
- Solutions, P (898)
- Solutions, Q (5)
- Solutions, R (82)
- Solutions, S (1020)
- Solutions, T (441)
- Solutions, U (27)
- Solutions, V (32)
- Solutions, W (46)
- Solutions, X (10)
- Solutions Y (7)
- Solutions, Z (65)
- Solvents, A (236)
- Solvents, B (119)
- Solvents, C (169)
- Solvents, D (293)
- Solvents & Dispensers (23)
- Solvents, E (155)
- Solvents, F (35)
- Solvents, G (33)
- Solvents, H (134)
- Solvents, I (90)
- Solvents J (1)
- Solvents, K (10)
- Solvents, L (1)
- Solvents, M (235)
- Solvents, N (29)
- Solvents, O (19)
- Solvents, P (222)
- Solvents, Q (1)
- Solvents, R (21)
- Solvents, S (95)
- Solvents, T (232)
- Solvents U (2)
- Solvents, W (96)
- Solvents, X (38)
- Source Media (2)
- Spa Equipment & Supplies (2)
- Spa Products (5)
- Spatulas (77)
- Spatulas, Hand Tools (3)
- Spatulas - Sterile (2)
- Specialty (122)
- Specialty Finger Tape (1)
- Specialty Pipet Tips, Liquid Handling (6)
- Specialty Plates, Automation & Robotics (6)
- Specimen Containers, Lab (5)
- Specimen Containers, Plastic (1)
- Spectrometers (183)
- Spectrophotometer Cells/Cuvettes (331)
- Spectrophotometers (160)
- Spill Control (150)
- Spill Kits (8)
- Spill Management - Solidifiers (2)
- Spill Pads & Mats (23)
- Spill Rolls (3)
- Spill Socks (1)
- Spinal Needles (10)
- Spin Columns (33)
- Spin Columns & Tubes, Extraction Kits (28)
- Spirometry (1)
- Splints and Braces (2)
- Sponges (6)
- Sponges, Cleanroom (7)
- Spray Bottles, Plastic (2)
- Spray Chambers (28)
- Sprays (5)
- SQ Quality Assurance (30)
- Squeegees, Cleanroom (15)
- Stainless (1)
- Stains & Dyes (458)
- Stains & Dyes, Detection (12)
- Standard (67)
- Standard Catheters (5)
- Standards (38)
- Standards, A (403)
- Standards, B (278)
- Standards, C (626)
- Standards, D (248)
- Standards, E (150)
- Standards, F (159)
- Standards, G (126)
- Standards, H (106)
- Standards, I (268)
- Standards, J (9)
- Standards, K (22)
- Standards, L (131)
- Standards, M (437)
- Standards, N (260)
- Standards, O (110)
- Standards, P (407)
- Standards, Q (34)
- Standards, R (71)
- Standards, S (2152)
- Standards, T (574)
- Standards, U (110)
- Standards, V (84)
- Standards, W (72)
- Standards, X (8)
- Standards, Y (39)
- Standards, Z (58)
- Static Eliminators (13)
- Steam Cleaners (1)
- Stem & Specialty Cell Culture (60)
- Step Stools (1)
- Sterilants Test Strips (1)
- Sterile (57)
- Sterile Alcohol (1)
- Sterile Liners (1)
- Sterile Nitrile Gloves (3)
- Sterile Pouches (4)
- Sterile Scalpels & Blades (5)
- Sterile Swabs (1)
- Sterile Trash Liners (1)
- Sterile Wipers & Prep Pads (6)
- Sterile Wraps (11)
- Sterilization Biological Indicators (9)
- Sterilization Cabinets, Covid-19 Employee Re-Entry Supplies (2)
- Sterilization Indicators (57)
- Sterilization Record Keeping (3)
- Sterilized Syringes & Needles (9)
- Stethoscope Replacement Parts (2)
- Stethoscopes (35)
- Sticky Mat Frames & Mounts (3)
- Sticky Mats / Tacky Floor Mats (38)
- Sticky Roller Handles (2)
- Stir Bars (89)
- Stirrers (329)
- Stockinette (5)
- Stopcocks (177)
- Stoppers (159)
- Stoppers & Plugs, Glass (1)
- Storage Bins (34)
- Storage Boxes, Sample Management (14)
- Storage Vials, Histology (1)
- Strainers, Virology (2)
- Strep (13)
- Streptavidin (43)
- Stretcher Sheets (13)
- Student Kits (120)
- Substrates (234)
- Sugars (154)
- Sundry Jars / Storage Containers (3)
- Supplies (5)
- Surface Wipes (3)
- Surgical Apparel (1)
- Surgical / OR Trays (28)
- Suture / Staple Removal Trays (2)
- Swabs, Covid-19 Sample Collection (12)
- Syringe Barrels (35)
- Syringe Filters, Virology (2)
- Syringe/Needle Combos (16)
- Syringes (580)
- Systems (5)
- Table Paper (22)
- Tables (68)
- Tanks (29)
- Tape Dispensers (5)
- Tape Measures (1)
- Taper Tips (13)
- Tapes (99)
- TAQ, Amplification (31)
- Targets (79)
- Tecan Compatible Tips (26)
- Techniplast (67)
- Temperature Monitoring, Covid-19 Employee Re-Entry Supplies (3)
- Tensiometers (2)
- Termperature Control (8)
- Tersaki Microplates, Serology (3)
- Tests (2)
- Test Strips (32)
- Test Strips, Lab (1)
- Thermal Cyclers (27)
- Thermal Cyclers, Detection (10)
- Thermally Conductive (1)
- Thermometers (521)
- Thermometer Sheaths & Probe Covers (3)
- Thermoregulators (26)
- Thermo Scientific Compatible Tips (1)
- Thermo Scientific Finnpipette (21)
- Thomas® Brand (1)
- Timers & Stopwatches (91)
- Tip Caps (1)
- Tips (2)
- Tissue Cassettes, Histology (11)
- Tissue Culture Hormones (39)
- Tissue Culture Systems (18)
- Tissues, Janitorial (1)
- Titrants (317)
- Titration (80)
- Tongs (24)
- Tool Boxes (6)
- Tools (1601)
- Toploading Balances (39)
- Torches (80)
- Torso (1)
- Torso Splints and Braces (5)
- Tourniquets (4)
- Tourniquets, Blood Collection (6)
- Trach (5)
- Tracheostomy (13)
- Traction (1)
- Traffic Cones (3)
- Transfer Pipets, Covid-19 LF Detection (1)
- Transfer Pipets, Liquid Handling (7)
- Transilluminators (29)
- Transportation (1)
- Transport Devices (5)
- Traps (68)
- Trashcans & Liners (12)
- Trash Liners (4)
- Trash Liners, Lab Disposal (2)
- Tray Covers (3)
- Trays (150)
- Trays / Catheters (1)
- Trichomonas Vaginalis (4)
- Tube Filters, Virology (1)
- Tubes (761)
- Tubes, Automation & Robotics (11)
- Tubes, Collection (19)
- Tubes, Covid-19 Sample Collection (1)
- Tubes, Storage (42)
- Tubes, Strips, and Caps, Amplification (24)
- Tubing (745)
- Tubing & Hoses, Plastic (23)
- Tubular (7)
- Tuning Forks (1)
- Tweezers (6)
- Tweezers, Hand Tools (40)
- Ultrasonic Cleaners (52)
- Ultrasonic Cleaning Supplies (2)
- Ultrasound Accessories / Supplies (3)
- Ultrasound Equipment (1)
- Undercast Padding (5)
- Underpads (2)
- Upper Extremities (14)
- Upper Extremities Splints and Braces (8)
- Urinalysis (3)
- UV Sterilization, Covid-19 Disinfectants and Sanitizers (1)
- Vacuum Aspirators, Liquid Handling (1)
- Vacuum Filters (2)
- Vacuuming Sealing Wax, Lab (1)
- Vacuum Ovens (38)
- Vials (1416)
- Vials & Septa, Glass (3)
- Vials, Storage (25)
- Vinyl Cleanroom - Bagged (1)
- Vinyl Powder-Free (4)
- Vinyl Powder Free Boxed (9)
- Viral Gene Delivery (122)
- Viral/Pathogen (12)
- Viscometers (95)
- Vision Screening (1)
- Vital Signs Accessories (5)
- Vital Signs Monitors (2)
- Vortexers (40)
- VTM Preparation, Covid-19 Sample Collection (3)
- Walkers (1)
- Wash Bottles, Plastic (11)
- Washers, Glassware (82)
- Waste Accessories (1)
- Waste Receptacles (1)
- Watch Glasses (13)
- Water Purification (313)
- Water Quality (524)
- Weather Stations (1)
- Weigh Dishes, Lab (11)
- Weights (132)
- Welch (314)
- Western Blotting & ELISA (360)
- Wheelchair Accessories (2)
- Wheelchairs & Replacement Parts (1)
- Wine Analysis (3)
- Wiper Dispensers (1)
- Wipers (311)
- Wipes (2)
- Wipes, Covid-19 Disinfectants and Sanitizers (1)
- Wire (413)
- Wooden Stir Rods (1)
- Woodenware (8)
- Workstations, Amplification (7)
- Workstations, PCR (20)
- Work Tables (17)
- Wound Cleansers / Fillers (5)
- XEXM (1)
- X-Ray Detectable (1)
- Zip Closure (1)
- Zwitterionic (3)
- Less...
Manufacturer
Packaging Size
Packaging Type
Enzymes & Inhibitors
-
Hemoglobin
MP BiomedicalsFrom Beef Blood Autoclavable preparation To be used with GC Agar Base
Related Products: Hemoglobin
-
Antipain-dihydrochloride
G-Biosciences[(S)-1-Carboxy-2-Phenyl]-carbamoyl-Arg-Val-arginal Specificity: Inhibits Ca 2+ -dependent endopeptidases, including papain, trypsin-like serine proteases, some cysteine proteases and to a lesser extent plasmin. Higher specificity for trypsin and papain compared to leupeptin. Solubility: …
-
Protease Inhibitor Cocktail Set V, EDTA-Free
MilliporeSigmaA cocktail of four protease inhibitors for the inhibition of serine, cysteine, but not metalloproteases. Reconstitute each vial with 1 ml H2O to obtain a 100X stock solution. 1X stock solution contains 500 µM AEBSF, HCl, 150 nM Aprotinin, 1 µM E-64, and 1 µM Leupeptin Hemisulfate.…
-
-
-
-
Catalase from Bovine Liver
MP BiomedicalsCatalase from bovine liver is a homotetrameric enzyme that is primarily located in peroxisomes. Activates the decomposition of hydrogen peroxide Natural antioxidant used to study roles of reactive oxygen species Catalyzes the decomposition of hydrogen peroxide into water and oxygen …
Related Products: Catalase From Bovine Liver
-
-
-
-
Proteinase K
Bio Basic Inc.Proteinase K is a highly active and stable protease with low cutting specificity. The enzyme belongs to the group of subtilisine-related serine proteases and is strongly inhibited by PMSF.
Related Products: Proteinase K
-
-
-
-
cOmplete™, EDTA-free Protease Inhibitor Cocktail Tablets
MilliporeSigmaFeatures and Benefits Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a blend of…
Related Products: Protease Inhibitor Cocktail Tablets
-
Macerozyme R-10
RPI (Research Products International)Macerating enzyme from Rhizopus sp. Often used in combination with Cellulase (C32200). Optimum pH range 3.5 - 7.0.
Related Products: Macerozyme R10
-
Collagenase Type IV from Clostridium histolyticum
MP BiomedicalsCollagenases degrade native helical collagen fibrils. It has an important role in connective tissue metabolism and is produced by specific cells involved in repairs and remodelling processes. Collagenase is used for tissue dissociation combined with other enzymes such as elastase, trypsin,…
Related Products: Type Iv Collagenase
-
-
Roche cOmplete™, EDTA-free Protease Inhibitor Cocktail
MilliporeSigmaTablets provided in glass vials Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a…
Related Products: Complete Edta Free
-
FITC Labeled ß-Amyloid Peptide 1-40
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
-
-
Coenzyme A
RPI (Research Products International)Extracted from yeast. Coenzyme A is a coenzyme, notable for its role in the synthesis and oxidation of fatty acids, and the oxidation of pyuvate in the citric acid cycle.
-
Lysozyme
Bio Basic Inc.Lysozyme is a single chain polypeptide of 129 amino acids cross-linked with four disulfide bridges. It hydrolyzes ß(1→4) linkages between N-acetylmuraminic acid and N-acetyl-D-glucosamine residues in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrin. The enzyme is…
Related Products: Lysozyme
-
-
1, 10-Phenanthroline
RPI (Research Products International)Forms a complex with ferrous ions. It can be used as an indicator in oxidation-reduction systems in fitrating ferrous salts. Material passes test for redox indicator and passes test for iron determination.
Related Products: Phenanthroline Indicator
-
-
-
IPTG (Isopropyl ß-D-1-thiogalactopyranoside), is a molecular biology reagent. This compound is a molecular mimic of allolactose, a lactose metabolite that triggers transcription of the lac operon and it is therefore used to induce protein expression where the gene is under the control of the…
Related Products: Iptg
-
