Enzymes & Inhibitors

Compare Tool

Select up to 3 products

HomeAll Products

Enzymes & Inhibitors

1 - 32 of 2786
Sort
View
Show
  • Hemoglobin

    MP Biomedicals

    From Beef Blood Autoclavable preparation To be used with GC Agar Base

  • Antipain-dihydrochloride

    G-Biosciences

    [(S)-1-Carboxy-2-Phenyl]-carbamoyl-Arg-Val-arginal Specificity: Inhibits Ca 2+ -dependent endopeptidases, including papain, trypsin-like serine proteases, some cysteine proteases and to a lesser extent plasmin. Higher specificity for trypsin and papain compared to leupeptin. Solubility: …

  • A cocktail of four protease inhibitors for the inhibition of serine, cysteine, but not metalloproteases. Reconstitute each vial with 1 ml H2O to obtain a 100X stock solution. 1X stock solution contains 500 µM AEBSF, HCl, 150 nM Aprotinin, 1 µM E-64, and 1 µM Leupeptin Hemisulfate.…

  • Ro-20-1724

    MilliporeSigma

  • QX-314

    MilliporeSigma

  • Catalase from bovine liver is a homotetrameric enzyme that is primarily located in peroxisomes. Activates the decomposition of hydrogen peroxide Natural antioxidant used to study roles of reactive oxygen species Catalyzes the decomposition of hydrogen peroxide into water and oxygen …

  • KN-93 (KN93)

    MilliporeSigma

  • Proteinase K

    Bio Basic Inc.

    Proteinase K is a highly active and stable protease with low cutting specificity. The enzyme belongs to the group of subtilisine-related serine proteases and is strongly inhibited by PMSF.

  • PTP LYP Inhibitor

    MilliporeSigma

  • Features and Benefits Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a blend of…

  • Macerozyme R-10

    RPI (Research Products International)

    Macerating enzyme from Rhizopus sp. Often used in combination with Cellulase (C32200). Optimum pH range 3.5 - 7.0.

  • Collagenases degrade native helical collagen fibrils. It has an important role in connective tissue metabolism and is produced by specific cells involved in repairs and remodelling processes. Collagenase is used for tissue dissociation combined with other enzymes such as elastase, trypsin,…

  • DEPC

    RPI (Research Products International)

    Modification reagent for His and Tyr residues in proteins. Inhibitor of nucleases. DEPC treated water is used in handling of RNA in the laboratory to reduce the risk of RNA being degraded by RNases.

  • Tablets provided in glass vials Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a…

  • The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

  • Bestatin

    MilliporeSigma

  • Lysozyme

    RPI (Research Products International)

    Purified from chicken egg white, 2x crystallized, dialyzed and supplied as a salt free lyophilized powder. Stable for 3 - 5 years when stored dry at 2°C to 8°C.

  • Coenzyme A

    RPI (Research Products International)

    Extracted from yeast. Coenzyme A is a coenzyme, notable for its role in the synthesis and oxidation of fatty acids, and the oxidation of pyuvate in the citric acid cycle.

  • Lysozyme

    Bio Basic Inc.

    Lysozyme is a single chain polypeptide of 129 amino acids cross-linked with four disulfide bridges. It hydrolyzes ß(1→4) linkages between N-acetylmuraminic acid and N-acetyl-D-glucosamine residues in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrin. The enzyme is…

  • 1, 10-Phenanthroline

    RPI (Research Products International)

    Forms a complex with ferrous ions. It can be used as an indicator in oxidation-reduction systems in fitrating ferrous salts. Material passes test for redox indicator and passes test for iron determination.

  • IPTG (Isopropyl ß-D-1-thiogalactopyranoside), is a molecular biology reagent. This compound is a molecular mimic of allolactose, a lactose metabolite that triggers transcription of the lac operon and it is therefore used to induce protein expression where the gene is under the control of the…

  • Bisindolylmaleimide IV

    MilliporeSigma

Compare Tool

Select up to 3 products

Please Log In

Don't have a web profile? Create one now.