Enzymes & Inhibitors

Compare Tool

Select up to 3 products

HomeAll Products

Enzymes & Inhibitors

1 - 32 of 2882
Sort
View
Show
  • Piceatannol

    MP Biomedicals

    Wide range of tyrosine and serine/threonine protein kinase inhibitor, including Syk, p56lck, PKA, PKC, MLCK, CDPK, JNK and PI3K. Inhibits the tyrosine phosphorylation of STAT3 and STAT5. Potent apoptosis inducer. Potent anticancer compound. Suppresses NF-kB activation through IkBalpha kinase…

  • Features and Benefits Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a blend of…

  • Glucose oxidase is an FAD-containing glycoprotein. The enzyme is specific for β-D-glucose. O can be replaced by hydrogen acceptors such as 2,6-dichlorophenol indophenol. Glucose oxidase from Aspergillus niger is a dimer consisting of 2 equal subunits with a molecular mass of 80 kDa each. Each…

  • Paclitaxel

    MP Biomedicals

    Anticancer compound. Chemotherapeutic used in patients with cancer and advanced forms of Kaposi's sarcoma. Microtubule assembly stabilizer. Reversibly binds to polymerized tubulin. Anti-mitotic. Mitotic spindle assembly, chromosome segregation and cell division inhibitor. Induces cell cycle…

  • Proteinase K is a highly active stable endopeptidase with a broad spectrum of action was isolated by E. Merk's Darmstadt Biochemical Research Department in 1970 from a culture filtrate of the fungus, Tritirachium album Limber. This fungus is able to grow on Keratin (e.g., wool, horn particles)…

  • Rac1 Inhibitor

    MilliporeSigma

  • Lecithin

    RPI (Research Products International)

  • Juglone

    MilliporeSigma

  • Lysozyme

    RPI (Research Products International)

    Purified from chicken egg white, 2x crystallized, dialyzed and supplied as a salt free lyophilized powder. Stable for 3 - 5 years when stored dry at 2°C to 8°C.

  • 4-Nitrocatechol Sulfate

    RPI (Research Products International)

  • Tablets provided in glass vials Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a…

  • Macerozyme R-10

    RPI (Research Products International)

    Macerating enzyme from Rhizopus sp. Often used in combination with Cellulase (C32200). Optimum pH range 3.5 - 7.0.

  • Immobilized Aprotinin

    G-Biosciences

    Aprotinin is a monomeric globular protein which inhibits several serine proteases including trypsin, chymotrypsin, plasmin and kallikrein. Furthermore, its action on kallikrein leads to inhibition of formation of factorXIIa. The binding of aprotinin to proteases is reversible with dissociation of…

  • Trypsin 0.25%-EDTA 0.02%

    Quality Biological

    Trypsin is a proteolytic enzyme used to detach adherent cell from culture vessel surfaces. Typical use includes removing adherent cells from a culture surface. Applications Trypsin is a serine protease derived from porcinepancreas. It is a single chain polypeptide of 223 amino acid residue…

  • Thrombin from Bovine

    MP Biomedicals

    α-Thrombin is a trypsin-like serine protease involved in a multitude of processes in the human body. Thrombin generation is the result of limited proteolysis of the vitamin K-dependent zymogen prothrombin. Thrombin is the last enzyme in the clotting cascade functioning to cleave fibrinogen to…

  • The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

  • Hyaluronidase is a glycoprotein containing 5% mannose and 2.17% glucosamine, it catalyzes the random hydrolysis of 1,4-linkages between 2-acetamido- 2-deoxy- b-D-glucose and D-glucose residues in hyaluronate. Hyaluronidase from bovine testes is a tetramer consisting of 4 equal subunits with a…

  • Tamoxifen Citrate

    MilliporeSigma

  • Ezh2 Inhibitor II, EI1

    MilliporeSigma

  • Taq DNA Polymerase

    G-Biosciences

    Taq DNA Polymerase is a highly thermostable recombinant DNA polymerase derived from the thermophile, Thermus aquaticus. The molecular weight of the recombinant protein is 94kD.. The Taq polymerase is able to amplify DNA up to 5kb with an elongation velocity of 0.9-1.2kb/min at 70-75°C. The…

  • Caffeine

    MilliporeSigma

  • Proteinase K

    RPI (Research Products International)

    From Tritirachium album. Serine protease for protolytic inactivation of nucleases during isolation of DNA and RNA.

  • IPTG (Isopropyl ß-D-1-thiogalactopyranoside), is a molecular biology reagent. This compound is a molecular mimic of allolactose, a lactose metabolite that triggers transcription of the lac operon and it is therefore used to induce protein expression where the gene is under the control of the…

  • 1, 10-Phenanthroline

    RPI (Research Products International)

    Forms a complex with ferrous ions. It can be used as an indicator in oxidation-reduction systems in fitrating ferrous salts. Material passes test for redox indicator and passes test for iron determination.

  • Deoxyribonuclease from beef pancreas, DNase I, was first crystallized by Kunitz. It is an endonuclease which splits phosphodiester linkages, preferentially adjacent to a pyrimidine nucleotide yielding 5'-phosphate terminated polynucleotides with a free hydroxyl group on position 3'. The…

  • Furin, Human, Recombinant

    MilliporeSigma

Compare Tool

Select up to 3 products

Please Log In

Don't have a web profile? Create one now.