Enzymes & Inhibitors

Compare Tool

Select up to 3 products

HomeAll Products

Enzymes & Inhibitors

1 - 32 of 2914
Sort
View
Show

Attention Thomas Scientific Customers

Due to current pandemic, lead times for PPE items are longer than what is listed on our website. Please expect shipping delays of all PPE products during this time.

  • Beta-Lactamase from Bacillus cereus 569/H9

    MP Biomedicals

    Each vial contains approximately 500 units beta-lactamase I and 50 units of beta-lactamase II., Solid. Beta-lactamases are enzymes produced by some bacteria and are responsible for their resistance to beta-lactam antibiotics. The lactamase enzyme breaks the β-lactam ring open, deactivating…

  • Proteinase K

    Bioline

    Proteinase K is a highly active serine protease with broad cleavage specificity on native and denatured proteins. Proteinase K is widely used in the purification of native RNA and DNA from tissues or cell lines, as well as for many other applications. Product Highlights High…

  • Protocatechuate 3,4-Dioxygenase from Pseudomonas sp., lyophilized powder, >=3…

    MilliporeSigma

    CAS Number: 9029-47-4 MDL No.: MFCD00132132 Storage: -20C Enzyme Commission (EC) Number: 1.13.11.3  ( BRENDA   IUBMB ) UNSPSC Code: 12352204 Application: The enzyme has been used to create an oxygen scavenging system along with protocatechuate (PCA) and…

  • ß-Amyloid Peptide 40-1 (Reverse)

    EZBiolab

    The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

  • X-a-Gal Powder

    Growcells

    Synonyms: 5-Bromo-4-Chloro-3-Indolyl-a-D Galactopyranoside, X-a-Gal, X-alpha-Gal Chromogenic substrate used to demonstrate a-galactosidase activity. Yeast that are positive for this enzyme will produce blue colonies when grown in the presence of X-a-Gal. Can be dissolved in DMF. Storage:…

  • Lysozyme

    RPI (Research Products International)

    Purified from chicken egg white, 2x crystallized, dialyzed and supplied as a salt free lyophilized powder. Stable for 3 - 5 years when stored dry at 2°C to 8°C.

  • Proteinase K Solution

    Bioline

    Proteinase K is a highly active serine protease (MW 28,500 Da) isolated from the fungus Tritirachium album. The enzyme exhibits broad cleavage specificity on native and denatured proteins and is widely used in the purification of native RNA and DNA from tissues or cell lines. Because the solution…

  • Diamide

    MP Biomedicals

    Diamide is used as a thiol oxidizing agent. It has also been used to titrate protein glutathiolation to discriminate from other oxidative protein modifications. Diamide treatment increased protein glutathiolation in a concentration-dependent manner and had comparably little effect on…

  • Doxorubicin [2mM]

    G-Biosciences

    ((8S,10S)-10-(4-amino-5-hydroxy-6-methyl-tetrahydro-2H-pyran-2-yloxy)-6,8,11-trihydroxy-8-(2-hydroxyacetyl)-1-methoxy-7,8,9,10-tetrahydrotetracene-5,12-dione) Doxorubicin (or hydroxyldaunorubicin) is an anthracycline antibiotic that intercalates DNA, inhibiting the unwinding of DNA by…

  • Spermidine, Trihydrochloride

    MilliporeSigma

  • Capsaicin

    MilliporeSigma

  • AZOCOLL Substrate, 100 Mesh

    MilliporeSigma

  • 4-Methylumbelliferyl-α-D-galactoside

    RPI (Research Products International)

    Fluorescent substrate for α-D-Galactosidase.

  • DEPC

    RPI (Research Products International)

    Modification reagent for His and Tyr residues in proteins. Inhibitor of nucleases. DEPC treated water is used in handling of RNA in the laboratory to reduce the risk of RNA being degraded by RNases.

  • cOmplete™, EDTA-free Protease Inhibitor Cocktail Tablets

    MilliporeSigma

    Features and Benefits Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a blend of…

  • Pepsin 1:10,000

    Bio Basic Inc.

  • DNase I

    MilliporeSigma

  • PI 3-KDelta/Gamma Inhibitor XV, SW-14 (PI3K-d/g)

    MilliporeSigma

  • Endopeptidase Lys-C, A. lyticus

    MilliporeSigma

  • GP Antagonist-2A

    MilliporeSigma

  • Diacylglycerol Kinase Inhibitor II (DAG )

    MilliporeSigma

  • Hyaluronidase from Bovine Testes

    MP Biomedicals

    Hyaluronidase is a glycoprotein containing 5% mannose and 2.17% glucosamine, it catalyzes the random hydrolysis of 1,4-linkages between 2-acetamido- 2-deoxy- b-D-glucose and D-glucose residues in hyaluronate. Hyaluronidase from bovine testes is a tetramer consisting of 4 equal subunits with a…

  • Collagenase Type IV from Clostridium histolyticum

    MP Biomedicals

    Collagenases degrade native helical collagen fibrils. It has an important role in connective tissue metabolism and is produced by specific cells involved in repairs and remodelling processes. Collagenase is used for tissue dissociation combined with other enzymes such as elastase, trypsin,…

  • Methylene Blue

    MilliporeSigma

  • Zymolyase

    Zymo Research Corporation

    Zymolyase (100T equivalent) prepared from Arthrobacter luteus (essential enzyme activities: β-1,3-glucan laminaripentao hydrolase and β-1,3-glucanase). Provided lyophilized together with a buffer for reconstitution. Also available combined with RNase A (R-Zymolyase). …

  • Macerozyme R-10

    RPI (Research Products International)

    Macerating enzyme from Rhizopus sp. Often used in combination with Cellulase (C32200). Optimum pH range 3.5 - 7.0.

  • Roche cOmplete™, EDTA-free Protease Inhibitor Cocktail

    MilliporeSigma

    Tablets provided in glass vials Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a…

  • D-Lactose Monohydrate

    RPI (Research Products International)

  • Lipopolysaccharide, Salmonella typhimurium

    MilliporeSigma

  • FIROZEH X-Gal/IPTG Solution

    Growcells

    Ready to use X-Gal/IPTG solution designed for selection of cloning construct in LacZ expression in the presence of lacl repressor 8mg/mL each of X-Gal and IPTG Stable at 4C reducing freeze-thaw cycles that reduce selection efficiency. Produced from the non-toxic ingredients, eliminating…

  • IPTG (Isopropyl ß-D-1-thiogalactopyranoside)

    Bioline

    IPTG (Isopropyl ß-D-1-thiogalactopyranoside), is a molecular biology reagent. This compound is a molecular mimic of allolactose, a lactose metabolite that triggers transcription of the lac operon and it is therefore used to induce protein expression where the gene is under the control of the…

  • IPTG

    RPI (Research Products International)

    IPTG is combined with X-GAL to detect lac+ colonies or cells in a colorimetric assay. Distinguishes recombinants (white) from non- recombinants (blue) in cloning strategies using vectors such as Lambda-11, M13mp 18 and 19, pUC18 and 19, pUR222 containing the lacZ gene. Dioxane-Free Water…

Compare Tool

Select up to 3 products

Please Log In

Don't have a web profile? Create one now.