Chemicals Enzymes and Inhibitors
-
-
-
-
-
6-Benzylaminopurine (6-BAP)
Bio Basic Inc.The Bio Basic 6-Benzylaminopurine (6-BAP) with a composition of Application: For Laboratory Research Use Only
-
Protease Inhibitor Set
G-BiosciencesContains 12 ready-to-use individual protease inhibitors for characterization of protease activity. Each set contains the following protease inhibitors. See individual inhibitors for their specificities and other information.: AEBSF ALLN Antipain, dihydrochloride Aprotinin …
-
-
VariSafe™ RNA HIV-1 Gag Gene
VarizymesVarizymes offers a selection of VariSafe RNAs – nuclease-resistant, single-stranded RNAs, suitable as process controls for RNA extraction from various sample matrices. These specially-engineered, non-infectious, MS2 phage-like particles protect their contents from degradation by nucleases and…
-
-
Phosphoglucose Isomerase from Baker's Yeast
MP BiomedicalsPhosphoglucose Isomerase(PGI) is an enzyme crucial for the interconversion of D-glucose 6 phosphate and D-fructose 6-phosphate. Responsible for the second step of glycolysis Involved in glucogenesis Highly conserved in bacteria and eukaryotes Phosphoglucose Isomerase fuctions as an…
-
Protease Inhibitor Cocktail Set III, Animal-Free
MilliporeSigmaA cocktail of six protease inhibitors with broad specificity for the inhibition of aspartic, cysteine, and serine proteases as well as aminopeptidases. This cocktail is recommended for use with mammalian cell and tissue extracts. Each vial contains 100 mM AEBSF, HCl, 80 µM Aprotinin, 5 mM…
-
Yeast Lytic Enzyme from Arthrobacter luteus
MP BiomedicalsYeast lytic enzyme is used to digest the cell wall of active yeast cells. Yeast lytic enzyme is an enzyme preparation from a submerged culture of Arthrobacter luteus which effectively lyses cell walls of viable yeast cell. It is a lyophilized enzyme partially purified by affinity chromatography.…
-
SAN HQ Triton FREE
ArcticZymesSAN High Quality - Bioprocessing grade - Triton FREE S AN High Quality is the ultimate solution for efficient removal of nucleic acids in high-salt manufacturing and bioprocessing workflows. This nonspecific endonuclease has optimum activity at salt…
-
FITC Labeled ß-Amyloid Peptide 1-42
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
-
-
Proteinase K
Bio Basic Inc.Proteinase K: Activity: >30 units/mg protein (hemoglobin, pH7.5, 37oC) Unit definition: It is the amount of enzyme which releases at 37 oC in 1 min as many folinpositive amino acid and peptides from hemoglobin as 1umol of tyrosine. Features: Proteinase K is a highly active and stable…
-
Papain from Papaya Latex
MP BiomedicalsPapain is a sulfhydryl protease from Carica papaya latex. Cleaves peptide bonds of basic amino acids, leucine, or glycine Hydrolyzes esters and amides One unit will hydrolyze 1.0 µmole of N-alpha-benzoyl-L-arginine ethyl ester (BAEE) per minute at 25°C and pH 6.2 Papain…
-
-
RPI 1-O-Methyl a-D-mannopyranoside [Methyl-a-D-Mannopyranoside]
RPI (Research Products International)The RPI methyl-a-D-mannopyranoside with strong concentration levels should always be stored in a temperature of 2 to 8 degree C and is used in research and manufacturing applications. Application: For Research or Further Manufacturing use only
-
-
Chymostatin
RPI (Research Products International)Reversible serine protease inhibitor of a,b,y, and chymostatin, papain, and cathepsins A,B,C. Working concentrations: 10-100uM.
-
-
-
Trypsin 0.05%-EDTA 0.1%
Quality BiologicalTrypsin is a proteolytic enzyme used to detach adherent cell from culture vessel surfaces. Typical use includes removing adherent cells from a culture surface. Applications Trypsin is a serine protease derived from porcinepancreas. It is a single chain polypeptide of 223 amino acid residue…
-
RPI D-(-)Salicin
RPI (Research Products International)The RPI D-(-)salicin is suitable for use in research facilities and chemical laboratories to conduct wide range of experiments. It is available in sturdy bottle that endures heavy and rigorous usage. Application: Research or Further Manufacturing use only
-
-
-
Lysozyme
Bio Basic Inc.Lysozyme: Synonyms: Muramidase; Lysozyme c; Mucopeptide N-acetylmuramoylhydrolase Description: Lysozyme is a single chain polypeptide of 129 amino acids cross-linked with four disulfide bridges. It hydrolyzes ß(1→4) linkages between N-acetylmuraminic acid and N-acetyl-D-glucosamine…
-
Ribonuclease A from Bovine Pancreas
MP BiomedicalsRibonuclease belongs to pancreatic ribonuclease family. RNase A is an endoribonuclease that attacks at the 3¢ phosphate of a pyrimidine nucleotide. The sequence of pG-pG-pC-pA-pG will be cleaved to give pG-pG-pCp and A-pG. Ribonuclease A is used to remove RNA from DNA plasmid preparations…
-
-