Enzymes & Inhibitors, Chemicals
-
-
M-SAN HQ (Bioprocessing Grade) is the recent addition to our high salt tolerance nucleases portfolio. The biochemical properties of the SAN family of nucleases make them ideal for multiple bioprocessing and biomanufacturing workflows. M-SAN HQ has been developed to offer the optimal solution…
-
ß-Amyloid (1-42), Rat
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
-
Phosphoglucose Isomerase from Baker's Yeast
MP BiomedicalsPhosphoglucose Isomerase(PGI) is an enzyme crucial for the interconversion of D-glucose 6 phosphate and D-fructose 6-phosphate. Responsible for the second step of glycolysis Involved in glucogenesis Highly conserved in bacteria and eukaryotes Phosphoglucose Isomerase fuctions as an…
-
Pepsin from Porcine Stomach Mucosa
MP BiomedicalsPepsin, an acid protease, contains a proteolytic enzyme. Pepsin contains the "cathepsin" component which has milk curdling activity. It has a broad range of substrate activity and demonstrates an esterase acitivity. It generally attacks peptide bonds. Pepsin is a peptidase used to…
-
Varizymes offers a selection of VariSafe RNAs – nuclease-resistant, single-stranded RNAs, suitable as process controls for RNA extraction from various sample matrices. These specially-engineered, non-infectious, MS2 phage-like particles protect their contents from degradation by nucleases and…
-
-
Protease Inhibitor Cocktail I
RPI (Research Products International)Lyophilized blend of five inhibitors for inhibiting a broad range of proteasesand esterases. Reconstitutes with 1 ml of water to produce a 100X concentrate solution. Contains: AEBSF E-64 Leupeptin Aprotinin EDTA Specificity: Serine Proteases Esterases …
-
-
-
E-64
RPI (Research Products International)Irreversible cysteine protease inhibitor of calpain, cathepsin (B,H,L,S), papain and other cysteine proteases. Working concentration: 1-10uM.
-
-
-
Aldehyde Dehydrogenase from Yeast
MP BiomedicalsAldehyde dehydrogenase belongs to the family of oxidoreductases, specifically those acting on the aldehyde or oxo group of donor with NAD+ or NADP+ as acceptor. Aldehyde dehydrogenase oxidizes a number of aliphatic and aromatic aldehydes. Acetyl-GSH is not hydrolyzed. Aldehyde…
-
-
-
ReleaseIt™ ß-agarase
VarizymesReleaseIt ß-Agarase has a high tolerance to inhibitors in electrophoretic buffers such as TBE and TAE, eliminating the need to perform a buffer exchange step before digestion. ReleaseIt ß-Agarase has higher thermostability than other commercially available ß-agarases, with a…
-
-
-
Catalase from Aspergillus niger
MP BiomedicalsCatalase, Fungal suspension from from Aspergillus niger is long-acting, extremely stable form of catalase that is active over a wide pH range. Composed of four protein subunits Each subunit contains a heme group bound to its active site Catalase is used for the removal of peroxides,…
-
RPI D-Lactose Monohydrate
RPI (Research Products International)The RPI D-lactose monohydrate is suitable for use in research facilities and chemical laboratories to conduct wide range of experiments. It is available in sturdy bottle that endures heavy and rigorous usage. Application: For Research or Further Manufacturing use only
-
-
ProteCEASE™
G-BiosciencesProteCEASE™ is a dry format version of our ProteaseARREST™ for large scale preparative applications and for those who prefer reconstitution prior to use. ProteCEASE™ is a superior general protease inhibitor cocktail that is suitable for purification from mammalian, plant,…
-
Glyphosate
RPI (Research Products International)Inhibits EPSPS enzyme involved in the Shikimate pathway.
-
-
Tn5 Transposase
VarizymesTn5 transposase (Tnp) is a hyperactive retroviral integrase that is used to construct random next-generation sequencing libraries and to study chromatin structure using targeted ATAC-seq. Tn5 transposase can be used to randomly fragment any target DNA and insert unique oligonucleotide adapters in a…
-
MOG 35-55
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: MEVGWYRSPFSRVVHLYRNGK
-
RPI 4-Nitrophenyl Phosphate Disodium Salt Hexahydrate
RPI (Research Products International)The RPI 4-nitrophenyl phosphate disodium salt hexahydrate is suitable for use in research facilities and chemical laboratories to conduct wide range of experiments. It is available in sturdy bottle that endures heavy and rigorous usage. Application: Research or Further Manufacturing use only
-
D-Luciferin, Free Acid
RPI (Research Products International)Used with firefly luciferase in bioluminescence for the determination of ATP.
-