One Component Microwell Peroxidase Substrate with excellent performance characteristics, good stability and wide working range. Develops blue-green color measurable between 405 nm and 410 nm.

Varizymes offers a selection of VariSafe RNAs – nuclease-resistant, single-stranded RNAs, suitable as process controls for RNA extraction from various sample matrices. These specially-engineered, non-infectious, MS2 phage-like particles protect their contents from degradation by nucleases and…

IsoPol® BST+ is a heat-tolerant Bst polymerase (large fragment) with enhanced strand-displacement activity. IsoPol® BST+ is active from 25 to 65°C. It is lacking 5’-3’- and 3’-5’-exonuclease activity. Properties Unit Definition: One unit is defined as…

Lactase is an enzyme preparation produced by Aspergillus oryzae fermentation. Hydrolyzes Lactose Produces β-D-Galactose and a-D-Glucose One unit will hydrolyze 1.0 µmole of o-nitrophenyl-beta-D-galactoside to o-nitrophenol per minute at pH 4.5 and 30°C …

M-SAN HQ (Bioprocessing Grade) is the recent addition to our high salt tolerance nucleases portfolio. The biochemical properties of the SAN family of nucleases make them ideal for multiple bioprocessing and biomanufacturing workflows. M-SAN HQ has been developed to offer the optimal solution…

Fluorescent substrate for 4-Methylumbelliferyl-α-D-Glucosidase. 4-Methylumbelliferone <50ppm.

The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Ready-to-use high quality apoptosis inducers allow users an easy tool for induction of apoptosis in cultured cells. These stabilized reagent solutions have a long storage life and are easy to use. The selection of apoptosis inducers include actinomycin D, camptothecin, cycloheximide, dexamethasone,…

Phosphoglucose Isomerase(PGI) is an enzyme crucial for the interconversion of D-glucose 6 phosphate and D-fructose 6-phosphate. Responsible for the second step of glycolysis Involved in glucogenesis Highly conserved in bacteria and eukaryotes Phosphoglucose Isomerase fuctions as an…

A broad range, bacterial, 100X concentrated, ready-to-use protease inhibitor cocktail. Recom ProteaseArrest™ offers greater protection for recombinant proteins expressed and purified from bacteria. Inhibits bacterial serine, cysteine, metallo-and other bacterial specific proteases including…

From Trichadema Viride. Enzyme mixture often used in combination with Macerozyme R-10 (M22010) for isolation of plant protoplasts. One unit of Cellulase will liberate 1.0 µmole of glucose from carboxymethyl cellulose. Lyophilized powder Optimum pH range: 4-5

Iodoacetamide is a thiol reagent; alkylating reagent for cysteine and histidine residues in proteins. In the alkylation reaction, it reacts with histidine (such as in RNase), methionine and sulfhydryl groups of many proteins. Iodoacetamide can react with low molecular weight thiol compounds such as…

Immobilized Trypsin is TPCK Treated Trypsin immobilized on 4% agarose that eliminates the contamination of protein digests by the trypsin. The immobilized trypsin is readily removed by separating the agarose from the digestion solution. Trypsin is a serine endopeptidase that specifically…

Pepsin, an acid protease, contains a proteolytic enzyme. Pepsin contains the "cathepsin" component which has milk curdling activity. It has a broad range of substrate activity and demonstrates an esterase acitivity. It generally attacks peptide bonds. Pepsin is a peptidase used to…

Trypsin is a serine endopeptidase that specifically cleaves peptide bonds on the carboxy side of s-aminoethyl cysteine, arginine and lysine residues. Typically there is little or no cleavage at arginyl-proline and lysyl-proline bonds. This trypsin is purified from bovine pancreas, 1X…