Chemicals Enzymes and Inhibitors
-
-
Pyridoxal Hydrochloride
Bio Basic Inc.The Bio Basic Inc. pyridoxal hydrochloride is suitable for laboratory and research use.
-
M-SAN HQ (Bioprocessing Grade) is the recent addition to our high salt tolerance nucleases portfolio. The biochemical properties of the SAN family of nucleases make them ideal for multiple bioprocessing and biomanufacturing workflows. M-SAN HQ has been developed to offer the optimal solution…
-
Lysozyme
Bio Basic Inc.Lysozyme: Synonyms: Muramidase; Lysozyme c; Mucopeptide N-acetylmuramoylhydrolase Description: Lysozyme is a single chain polypeptide of 129 amino acids cross-linked with four disulfide bridges. It hydrolyzes ß(1→4) linkages between N-acetylmuraminic acid and N-acetyl-D-glucosamine…
-
Varizymes offers a selection of VariSafe RNAs – nuclease-resistant, single-stranded RNAs, suitable as process controls for RNA extraction from various sample matrices. These specially-engineered, non-infectious, MS2 phage-like particles protect their contents from degradation by nucleases and…
-
-
-
-
elf18
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: Ac-SKEKFERTKPHVNVGTIG
-
-
-
-
-
(-)-Epigallocatechin gallate
MP BiomedicalsPotent anticancer compound. Anti-angiogenic. VEGF, VE-cadherin phosphorylation, matrix metalloproteinase and urokinase-plasminogen activator (uPA) inhibitor. Anti-inflammatory. NF-kappaB inhibitor. Modulates chronic inflammatory diseases, such as type 2 diabetes, rheumatoid arthritis, inflammatory…
-
RPI Forskolin
RPI (Research Products International)The RPI forskolin is suitable for use in research facilities and chemical laboratories to conduct wide range of experiments. It is available in sturdy bottle that endures heavy and rigorous usage. Application: For Research or Further Manufacturing use only
-
Cytochalasin B
MP BiomedicalsCell permeable mycotoxin. Actin polymerization inhibitor. Binds to the barbed end of actin, reversibly inhibiting the elongation and shortening of actin filaments. Induces nuclear extrusion. By disrupting actin polymerization, blocks diverse cellular functions, including cell division, migration,…
-
Proteinase K
G-BiosciencesProteinase K (also protease K, endopeptidase K, peptidase K or Tritirachiumalkaline phosphatase) (EC 3.4.21.64) is a non-specifc, broad spectrum serine protease that is isolated from the saprophytic fungus Tritirachium album. Proteinase K is routinely used for the purification of target…
-
Laccase from Aspergillus sp.
MilliporeSigmaSynonym: Laccase from Aspergillus sp., Novozym 51003 CAS Number 80498-15-3 EC Number 420-150-4 General description Laccase EC 1.10.3.2, a glycoprotein, is an extracellular multicopper enzyme and is considered as a metal. Laccase is widely distributed in fungi and also found…
-
-
Tn5 Transposase
VarizymesTn5 transposase (Tnp) is a hyperactive retroviral integrase that is used to construct random next-generation sequencing libraries and to study chromatin structure using targeted ATAC-seq. Tn5 transposase can be used to randomly fragment any target DNA and insert unique oligonucleotide adapters in a…
-
-
-
-
-
-
FITC Labeled ß-Amyloid Peptide 1-42
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
-
DirecTaq™ 1X Master Mix
VarizymesDirecTaq DNA polymerase 1X Master Mix saves time and cost by enabling direct PCR amplification of unpurified templates. It contains a recombinant, truncated (lacks 5’ to 3’ exonuclease activity), highly thermostable DNA polymerase from the thermophilic bacterium Thermus aquaticus. The…
-
ReleaseIt™ ß-agarase
VarizymesReleaseIt ß-Agarase has a high tolerance to inhibitors in electrophoretic buffers such as TBE and TAE, eliminating the need to perform a buffer exchange step before digestion. ReleaseIt ß-Agarase has higher thermostability than other commercially available ß-agarases, with a…
-
-
Catalase from Aspergillus niger
MP BiomedicalsCatalase, Fungal suspension from from Aspergillus niger is long-acting, extremely stable form of catalase that is active over a wide pH range. Composed of four protein subunits Each subunit contains a heme group bound to its active site Catalase is used for the removal of peroxides,…