Chemicals Enzymes and Inhibitors
-
-
2,2'-Azino-bis-(3-ethylbenzthiazoline-6-sulfonic Acid) Solution is oxidized to a radical action showing absorption maxima at 820 nm, 734 nm, 650 nm and 405 nm, in the presence of hydrogen peroxide and HRP. The latter frequency demonstrates a significant molar extinction coefficient and is…
-
-
FITC Labeled ß-Amyloid Peptide 1-42
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
Thiamine Hydrochloride
MP BiomedicalsThiamine (Vitamin B1) is one of the essential vitamins and is required for carbohydrate metabolism. Thiamine hydrochloride is used as a food-additive to add a brothy/meaty flavor to gravies or soups. It is also used as food supplement. Used in fluorometric determination of mercury.
-
Trypsin from Beef Pancreas
MP BiomedicalsTrypsin consists of a single chain polypeptide of 223 amino acid residues. Member of the serine protease family Dissolves blood clots in its microbial form Treats inflammation in its pancreatic form Trypsin cleaves peptides on the C-terminal side of lysine and arginine residues.…
-
-
-
-
FOCUS™ ProteaseArrest™
G-BiosciencesFOCUS™ ProteaseArrest™ is a ready-to-use, 100X concentrated, broad range protease inhibitor cocktail that is fully compatible with 2D electrophoresis and subsequent mass spectrometry. The protease inhibitor cocktail contains reversible and irreversible inhibitors of serine, cysteine,…
-
-
RPI 1-O-Methyl a-D-mannopyranoside [Methyl-a-D-Mannopyranoside]
RPI (Research Products International)The RPI methyl-a-D-mannopyranoside with strong concentration levels should always be stored in a temperature of 2 to 8 degree C and is used in research and manufacturing applications. Application: For Research or Further Manufacturing use only
-
Protease Inhibitor Cocktail Set IV
MilliporeSigmaA cocktail of four protease inhibitors with broad specificity for the inhibition of aspartic-, cysteine-, metallo-, and serine-proteases. Recommended for fungal and yeast cell extracts. Each vial contains 100 mM AEBSF, HCl, 1.5 mM E-64, 2 mM Pepstatin A, and 500 mM 1,10-Phenanthroline. Supplied…
-
-
-
-
Deoxyribonuclease I from Bovine Pancreas
MP BiomedicalsDeoxyribonuclease from beef pancreas, DNase I, was first crystallized by Kunitz. It is an endonuclease which splits phosphodiester linkages, preferentially adjacent to a pyrimidine nucleotide yielding 5'-phosphate terminated polynucleotides with a free hydroxyl group on position 3'. The…
-
Spermine tetrahydrochloride
Bio Basic Inc.The Bio Basic Inc. spermine tetrahydrochloride is suitable for research and laboratory use. It is mainly used in DNA precipitation from low salt aqueous buffers. Application: For Laboratory Research Only
-
-
-
ß-Amyloid Peptide 40-1 (Reverse)
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
-
PHORBOL 12-MYRISTATE 13-ACETATE, 25 mg
MP BiomedicalsPMA activates Ca2+- ATPase and potentiates forskolin-induced cAMP formation. It has been shown to inhibit apoptosis induced by the Fas antigen, but PMA induces apoptosis in HL-60 promyelocytic leukemia cells.
-
M-SAN HQ (Bioprocessing Grade) is the recent addition to our high salt tolerance nucleases portfolio. The biochemical properties of the SAN family of nucleases make them ideal for multiple bioprocessing and biomanufacturing workflows. M-SAN HQ has been developed to offer the optimal solution…
-
-
Protease from Staphylococcus aureus V8 Strain
MP BiomedicalsProtease from Staphylococcus aureus strain V8 is composed of a single polypeptide chain. The Staphylococcus strain V8 protease specifically cleaves peptide bonds on the carboxyl (COOH) terminal side of aspartic and glutamic acid residues. Protease V8 is used for selective cleavage of proteins…
-
-
-
M-SAN HQ ELISA Kit
ArcticZymesArcticZymes offers M-SAN HQ ELISA Kit to confirm the removal of M-SAN High Quality (Bioprocessing Grade) in bioprocessing and biomanufacturing applications. Key features: Fast: 1.5 – 2 hours Sensitive: Quantification range: 0.12 – 7.5 ng/ml Accurate: 100%…
-
1, 10-Phenanthroline
RPI (Research Products International)Forms a complex with ferrous ions. It can be used as an indicator in oxidation-reduction systems in fitrating ferrous salts. Material passes test for redox indicator and passes test for iron determination.
-
-
The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
X-Phos, BCIP
RPI (Research Products International)Colorimetric substrate for Alkaline phosphatase activity in blotting immunohistochemical and cytochemistry techniques. Forms a purple insoluble precipitate when used in conjunction with NBT.