Cayman Chemical

A chemiluminescent substrate of firefly luciferase which produces light upon oxidative decarboxylation in the presence of ATP.

A single isomer derivative of 5(6)-carboxyfluorescein that can be used to fluorescently label biomolecules; excitation/emission maxima of 492 and 518 nm, respectively.

A synthetic oleanane triterpenoid that blocks iNOS and COX-2 synthesis in INF-γ-activated mouse macrophages (IC50 = 0.11 nM); induces apoptosis, induces differentiation, and inhibits the inflammatory response in various tumor cells and has potent antidiabetic activity.

A natural plant alkaloid commonly used to alleviate inflammation associated with rheumatoid arthritis; activates histamine release, reduces joint stiffness and pain, and alters cytokine generation; impairs signaling through NF-κB, resulting in immunosuppression as well as reduced inflammation...

A naturally occurring macrolide polyene used to treat fungal infections, including Candida, Aspergillus, Cephalosporium, Fusarium and Penicillium (minimal inhibitory concentrations ~ 4-64 μM); also used in the food industry as a "natural" preservative.

An internal standard for the quantification of EPA by GC- or LC-MS.

Source: Active human recombinant C-terminal His-tagged protein preceded by a linker region and V5 epitope expressed in E. coli Mr: 34 kDa

Arachidonoyl thio-PC is a substrate for cPLA2 by virtue of the presence of arachidonic acid at the sn-2 position of the glycerophospholipid. Hydrolysis of the arachidonoyl thioester bond at the sn-2 position by PLA2 releases free thiol which can be detected by DTNB. This assay can be used to...

A natural inhibitor of mitochondrial complex II with antibiotic activities.

A 15:0 saturated fatty acid found in the milk fat of ruminants that is used as a biological marker for the intake of dairy fat in the assessment of metabolic risk factors.

An inhibitor of ETV1 transcriptional activity that binds to ETV1 (KD = 17.1 µM in vitro), which reduces p300-dependent acetylation and stability of ETV1 and, thereby, promotes its degradation; dose-dependently prevents invasion of ETV1-reliant cancer cells in vitro.

A cell-permeable, fluorescein-based probe that selectively detects free Zn2+; excitation maximum = 515 nm.

An inhibitor of AADC, an enzyme that has dopamine decarboxylase activity, to block the conversion of L-DOPA to dopamine by AADC in the peripheral circulatory system.

Oleic acid ethyl ester is a neutral, more lipid-soluble form of oleic acid.

An antitumor antibiotic that inhibits DNA synthesis by promoting the selective cross-linking of both histone H3 and the heat shock protein, GRP78 to DNA when photoactivated by near-UV or visible light.

A selective histamine H3 receptor antagonist that crosses the blood-brain barrier; inhibits histamine binding in rat brain with an ED50 value of 10.5 mg/kg.

A depsipeptide antibiotic that contains two unusual amino acids (N-methylalanine and 4-methylproline) and features a pentaenone side chain; effective against Gram-positive bacteria, including methicillin-resistant S. aureus (MIC = 25 µg/ml), and Gram-negative bacteria, including mutant forms...

An antidiabetic drug and selective PPARγ agonist (EC₅₀ = 3.0 µM); active in vivo as an anti-hyperglycemic agent the ob/ob mouse model.

A selective, brain-penetrable LRRK2 inhibitor (Kis = 2 and 18.7 nM in biochemical and cell-based assays, respectively); inhibits LRRK2 Ser1292 autophosphorylation in BAC transgenic mice expressing human LRRK2 protein with the G2019S Parkinson’s disease mutation (IC₅₀ = 20 nM in...

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

A peptide that is identical in sequence to NF-κB inhibitor, except two essential, basic residues of the p105 NLS are substituted with non-basic amino acids; used as a negative control peptide.

PGF2α dimethyl amine is a derivative of PGF2α which was designed as a PG antagonist for in vitro and in vivo studies. PGF2α dimethyl amine is a weak FP receptor antagonist. In gerbil colon, PGF2α dimethyl amine at a dose of 3.2 µg/ml inhibits the contractile effects of...

A thienopyrrole-5-caboxamide compound that inhibits hepatic lipid droplet formation (IC₅₀ = 69.7 nM in mouse AML-12 hepatocytes).

A selective, short-acting adenosine A2A receptor agonist (Ki = 1.1 nM for pig striatum A2A receptor); used to induce hyperemia, particularly in the context of myocardial perfusion imaging.