• PRODUCT AVAILABILITY: Did you know you can view a product's availability right on the product page? Simply enter the quantity you want to purchase and the current availability will appear below the item.

  • This product requires a special fee, which will be shown on the Review page during Checkout.

Cayman Chemical

EP4 Receptor (C-Term) Blocking Peptide

Not yet rated

NOTE: Due to special handling or shipping requirements, these products will have additional fees added during checkout. Click HERE for a description of what fees might be charged.

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)

To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.

Please Enter Your Order Info

Filter by:

  • Clear Filters
Product Detail
Thomas No.
C790L65
Mfr. No.
301775-1
Description
EP4 Receptor (C-Term) Blocking Peptide
Packaging Size
1 each
Packaging Type
Tube, Plastic
list price/quantitytotal
$0.00
$0.00 (0 Items)
Product C790L65 is restricted and can only be purchased by customers with a web profile linked to a Thomas Business Account - Click here to login or create your web profile.

Write A Review