• PRODUCT AVAILABILITY: Did you know you can view a product's availability right on the product page? Simply enter the quantity you want to purchase and the current availability will appear below the item.

  • This product requires a special fee, which will be shown on the Review page during Checkout.

GenScript

SARS-CoV-2 Spike Glycoprotein RBD B.1.617.2-Delta

Not yet rated

NOTE: Due to special handling or shipping requirements, these products will have additional fees added during checkout. Click HERE for a description of what fees might be charged.

This pool is delivered in one pool of 53 peptides derived from a peptide scan through Spike glycoprotein - Receptor binding domain of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.617.2, India, Delta) covering the following mutations: L0452R and T0478K for T cell assays (e.g. ELISPOT).

Sequence:
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK
CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS
NNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQ
PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

SourceSevere Acute Respiratory Syndrome-related coronavirus 2 (Lineage B.1.617.2) Spike glycoprotein - Receptor-binding domain (covering the following mutations: L0452R and T0478K).
Gene IDS
Length223 aa
PurityCrude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide).
FormLyophilized
StorageStore at -20°C.
NoteThe peptides of this product are supplied as trifluoroacetate salts.

Please Enter Your Order Info

Filter by:

  • Clear Filters
Product Detail
Thomas No.
CHM03U912
Mfr. No.
RP30034
Description
SARS-CoV-2 Spike Glycoprotein RBD B.1.617.2-Delta,1vial(25µg/peptide)
list price/quantitytotal
$0.00
$0.00 (0 Items)

Write A Review