• PRODUCT AVAILABILITY: Did you know you can view a product's availability right on the product page? Simply enter the quantity you want to purchase and the current availability will appear below the item.

  • This product requires a special fee, which will be shown on the Review page during Checkout.

MilliporeSigma

Membrane Scaffold Protein 1D1 recombinant, expressed in E. coli

Not yet rated

NOTE: Due to special handling or shipping requirements, these products will have additional fees added during checkout. Click HERE for a description of what fees might be charged.

Synonym: MSP1D1, MSP1T2

Biochem/physiol Actions
Generates Nanodiscs ~9.7 nm in diameter

Legal Information
Nanodisc technology, and many of its uses, are covered by the following patents held by the University of Illinois.

  • 7,691,414 Membrane scaffold proteins
  • 7,662,410 Membrane scaffold proteins and embedded membrane proteins
  • 7,622,437 Tissue factor compositions and methods
  • 7,592,008 Membrane scaffold proteins
  • 7,575,763 Membrane scaffold proteins and tethered membrane proteins
  • 7,083,958 Membrane scaffold proteins
  • 7,048,949 Membrane scaffold proteins

 

Physical Form
Supplied as a lyophilized histidine-tagged protein with a TEV protease cleavage site stabilized with Tris-HCl, EDTA, and NaCl.

Application
Nanodisc soluble lipid bilayer systems have proven to be a widely applicable means for rendering membrane proteins soluble in aqueous solutions in a native-like bilayer environment where they remain monodisperse and active. The critical component of nanodiscs is the encircling amphipathic helical protein belt (membrane scaffold protein).

The nanodisc system has been employed to incorporate a wide variety of proteins including GPCRs, P450s, bacteriorhodopsin, coagulation factors, cholera toxin, TAR receptor and aromatase.

Physical properties
Sequence: GHHHHHHHDYDIPTTENLYFQGSTFSKLREQLGPVTQEFWD
NLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLR
AELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQR
LAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLE
SFKVSFLSALEEYTKKLNTQ

Recombinant: expressed in E. coli

Description: N-Terminal histidine-tagged

Form: lyophilized powder

Mol. Wt.: Mw 24661.9 by amino acid sequence

Absorption: extinction/280 nm 18200 M-1cm-1 (for the His-tag-cleaved form dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.)

extinction/280 nm 21000 M-1cm-1 (for the uncleaved His-tagged form dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.)

Storage Temp.: −20°C

Please Enter Your Order Info

Filter by:

  • Clear Filters
Product Detail
Thomas No.
C974M54
Mfr. No.
M6574-5MG
Description
Membrane Scaffold Protein 1D1, 5 mg
list price/quantitytotal
$0.00
$0.00 (0 Items)
Product C974M54 is restricted and can only be purchased by customers with a web profile linked to a Thomas Business Account - Click here to login or create your web profile.

Write A Review