Synonym: MSP1D1, MSP1T2
Biochem/physiol Actions
Generates Nanodiscs ~9.7 nm in diameter
Legal Information
Nanodisc technology, and many of its uses, are covered by the following patents held by the University of Illinois.
- 7,691,414 Membrane scaffold proteins
- 7,662,410 Membrane scaffold proteins and embedded membrane proteins
- 7,622,437 Tissue factor compositions and methods
- 7,592,008 Membrane scaffold proteins
- 7,575,763 Membrane scaffold proteins and tethered membrane proteins
- 7,083,958 Membrane scaffold proteins
- 7,048,949 Membrane scaffold proteins
Physical Form
Supplied as a lyophilized histidine-tagged protein with a TEV protease cleavage site stabilized with Tris-HCl, EDTA, and NaCl.
Application
Nanodisc soluble lipid bilayer systems have proven to be a widely applicable means for rendering membrane proteins soluble in aqueous solutions in a native-like bilayer environment where they remain monodisperse and active. The critical component of nanodiscs is the encircling amphipathic helical protein belt (membrane scaffold protein).
The nanodisc system has been employed to incorporate a wide variety of proteins including GPCRs, P450s, bacteriorhodopsin, coagulation factors, cholera toxin, TAR receptor and aromatase.
Physical properties
Sequence: GHHHHHHHDYDIPTTENLYFQGSTFSKLREQLGPVTQEFWD
NLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLR
AELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQR
LAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLE
SFKVSFLSALEEYTKKLNTQ
Recombinant: expressed in E. coli
Description: N-Terminal histidine-tagged
Form: lyophilized powder
Mol. Wt.: Mw 24661.9 by amino acid sequence
Absorption: extinction/280 nm 18200 M-1cm-1 (for the His-tag-cleaved form dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.)
extinction/280 nm 21000 M-1cm-1 (for the uncleaved His-tagged form dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.)
Storage Temp.: −20°C