Pbs Powder

Compare Tool

Select up to 3 products

Pbs Powder
1 - 32 of 33
  • PBS, 10X Powder Concentrate

    RPI (Research Products International)

    PBS, 10X Powder Concentrate

  • QuickSilver™ PBS and PBST Powdered Buffer Packs

    Accuris Instruments

    …life QuickSilver™ PBS and PBST Because its osmolality and ion concentration closely mimic that of the human body, PBS is commonly used for cell culture applications, as well as HPLC and MS. PBST is a wash buffer and diluent for ELISA. The 1X PBS solution contains 137mN NaCl, 2.7mM…

  • HyClone™ Dulbecco's Phosphate Buffered Saline, Powder

    GE Healthcare

    Buffer cell culture with GE Healthcare HyClone Dulbecco's Phosphate Buffered Saline (PBS), powder.

  • SIGMA Macrophage Inflammatory Protein-3a human lyophilized powder (from PBS…


    Synonym(s): hMIP-3α; Exodus; LARC; MIP-3α MDL Number: MFCD01635053 Purity: ≥95% (SDS-PAGE) Storage: −20°C

  • ALDRICH Aldolase Antibody 38C2, murine catalytic monoclonal antibody, average Mw…


    MDL Number: MFCD01321648 Storage: −20°C

  • PBS Blocking Buffer with BSA

    Bio Basic Inc.

    PBS Blocking Buffer with BSA Premixed Powder is used for immunodetection assays such as Western blots, dot blots and ELISA. 1 pack will make 1 liter of 1X stremgth blocking solution contain 3% BSA.

  • JAW™ Modified Dulbecco's PBS Packs (for ELISA and Western Blots)


    Modified Dulbecco's PBS Packs (for ELISA and Western Blots) are dry-blend powder pouches used to make physiological Sodium- and Potassium- buffer saline (D-PBS) for ELISA and Western blot diluents and wash buffers. Features : Each pouch when dissolved in DI water and made to final…

  • JAW Dry Powder Buffer Packs


    Premixed buffer powders, just add water to generate a ready-to-use buffer. JAW™ Carbonate-Bicarbonate Buffer packs make 1L of 0.2M Carbonate-Bicarbonate buffer, pH 9.4. JAW™ Phosphate Buffered Saline (PBS) packs [1X] make 1L of 2.7mM potassium chloride, 137mM sodium chloride…

  • SIGMA Phosphate buffered saline pH 7.4, contains BSA, powder


    Synonym(s): PBS MDL Number: MFCD00131855 Storage: 2-8°C

  • SIGMA Phosphate buffered saline, pH 7.4, contains BSA, powder


    Synonyms: PBS Storage Temperature: 2-8°C Reconstitution: Contents of one pouch, when dissolved in one liter of distilled or deionized water, will yield 0.01 M phosphate buffered saline (NaCl, 0.138 M; KCl, 0.0027 M); bovine serum albumin - 1% w/v, pH 7.4 at 25-á°C. Packaging: Foil…

  • Phosphate buffered saline pH 7.4, contains TWEEN® 20, dry powder


    Synonyms: PBS MDL Number: MFCD00131855 Reconstitution: Contents of one pouch, when dissolved in one liter of distilled or deionized water, will yield 0.01 M phosphate buffered saline (NaCl 0.138 M; KCl - 0.0027 M); TWEEN ® 20 - 0.05%, pH 7.4, at 25-á°C. Legal…

  • Amyloid beta Protein Fragment 1-40, >=90% (HPLC), powder


    …tangles that occur in the hippocampus, neocortex, and amygdala of patients with Alzheimer's disease. Reconstitution: For maximal biological activity, dilute the stock in calcium-free PBS to 1 mg/ml and incubate at 37 C for 4 days. Other Notes: Lyophilized from 0.1% TFA in H2O

  • SIGMA Phosphate buffered saline with 5% nonfat milk, powder (dry milled), pH 7.3


    Synonym(s): PBS MDL Number: MFCD00131855

  • Anti-Potassium Channel KVbeta2 antibody produced in rabbit, affinity isolated…


    …synthetic peptide SPGMIYSTRYGSPKR(C), corresponding to amino acid residues 20-34 of rat KVbeta2. Physical form: Lyophilized powder from phosphate buffered saline (PBS), pH 7.4, containing 1% BSA and 0.25% sodium azide. Reconstitution: Reconstitute the lyophilized vial with 50muL or 200 muL…

  • SIGMA Phosphate buffered saline dry powder, pH 7.4, contains 3% nonfat milk


    Synonym(s): PBS MDL Number: MFCD00131855

  • Lead(II) sulfide, 99.9% trace metals basis

    BeanTown Chemical

    CAS: 1314-87-0 EC No: 215-246-6 MDL No: MFCD00016280 RTECS: OG4550000 UN No: UN3077; Haz Class: 9; Packing Group: III -200 Mesh Powder Molecular Formula: PbS MW: 239.25 Density (g/mL): 7.7

  • SIGMA Phosphate buffered saline, powder, pH 7.4


    Synonyms: PBS Reconstitution: Contents of one pouch, when dissolved in one liter of distilled or deionized water, will yield 0.01 M phosphate buffered saline (NaCl 0.138 M; KCl - 0.0027 M); pH 7.4, at 25-á°C. Packaging: Foil pouches

  • SIGMA Phosphate buffered saline, dry powder, pH 7.4, contains 3% nonfat milk


    Synonyms: PBS Application: Blocking buffer in Western blots or dot blots Reconstitution: Each pouch dissolved in 100 mL deionized water will yield 0.05-áM phosphate buffered saline, pH-á7.4 at 25-á°C, containing 3% (w/v) nonfat milk. Packaging: Foil pouches

  • SIGMA NGF-B from rat, recombinant, expressed in Sf21 cells, lyophilized powder,…


    …Factor-β from rat CAS No.: 86923-98-0 Purity: ≥97% (SDS-PAGE) Physical form: Lyophilized from a 0.2 μm filtered solution in PBS and 1 M NaCl containing 50 μg of bovine serum albumin per 1 μg of cytokine Analysis Note: The biological activity is measured in a…

  • SIGMA Stem Cell Factor human, recombinant, expressed in E. coli, powder,…


    Synonym(s): SCF; c- Kit ligand Purity: >97% (SDS-PAGE) Physical form: Lyophilized from a 0.2 μm filtered solution in PBS containg 50 μg BSA /μg cytokine. Analysis Note: The proliferative activity is tested in culture using TF-1 cells or by the dose dependent…

  • Protein G recombinant, from Escherichia coli, >=90%


    …surface protein produced by Streptococcus sp. It is composed of two or three nearly identical domains of 55 amino acids each. It binds to Fc fragment of IgG from many species with high affinity. It does not recognize IgM, IgA, IgE or serum albumin. Physical form: lyophilized powder in PBS, pH 7.4

  • Lead(II) sulfide ; >/=80% (Pb content)

    AFG Bioscience

    Purity Limit: ≥80% (Pb content) CAS No.: 1314-87-0 Molecular Formula: PbS Molecular Weight: 239.27 MDL No.: MFCD00016280 Appearance: Dark gray to black powder Storage Temperature: Store at RT

  • SIGMA Interleukin-6 human, recombinant, expressed in E. coli, lyophilized powder…


    Synonym(s): hIL-6; IL-6 Purity: ≥97% (SDS-PAGE) Physical form: Lyophilized from a 0.2 μm filtered solution of phosphate buffer saline (PBS), pH 7.4, containing 500 μg bovine serum albumin. Storage: −20°C

  • Tissue plasminogen activator human,


    …treatment of early thrombosis of HeartWare left ventricular assist devices with intraventricular thrombolytics. Physical form: Lyophilized powder, from 100 mM PBS (pH 7.4), 3.5 mg/mL L-arginine, and 0.001% Tween(R) 80 Preparation Note: Reconstitute with dH2O to a final concentration of 1 mg/mL…

  • SIGMA Dulbecco's Phosphate Buffered Saline, Modified, without calcium chloride…


    Synonym(s): DPBS Application: D-PBS is used to wash cells during preparation and serial transfer. Other Notes: This D-PBS is formulated without Ca or Mg. Formulations with Ca and Mg added are also available Storage: 2-8°C

  • Nitroreductase from Escherichia coli, >=90% (SDS-PAGE), recombinant, expressed…


    …nitro-containing drugs such as metronidazole by converting the nitro group to a cytotoxic nitro radical. Physical properties: Lyophilized powder containing PBS. Does not contain BSA as excipient Unit Definition: One unit will reduce one mumole of Cytochrome C per minute in the presence of…

  • Phosphate Buffered Saline


    …A 1X solution is prepared by dissolving 8.6g in 1L distilled water. Sufficient dry powder is supplied to prepare 10L of 1X Solution. Packaged as 1 x 1L, 2 x 1L or 5 x 1L packs Ultra Pure Grade, Powder Blend pH (9.88 g/L, water): 7.4 Solubility: Clear and haze-free Contains: 137mM…



    …shows improved results compared to milk powder preparations. NAP-BLOCKER™ is supplied as a pre-made, 2X concentrated solution; simply dilute with any buffer and block nitrocellulose or PVDF membranes. Alternatively, NAP-BLOCKER™ is supplied in PBS or TBS buffers. Features …

  • SingleShot Buffer Pouches


    …pre-measured powder in sealed pouches Fast – dissolve and use right away Standardized – guaranteed reproducible results for your electrophoresis gels and Western blots Buffer Selections: TGS (Tris-Glycine SDS) – Gel Running Buffer PBS (Phosphate Buffer…

  • Protein G (Recombinant)


    …a molecular mass of 21.6 kDa. The protein G migrates on SDS PAGE around 32kDa. Source: E. coli Formulation: lyophilized white powder Purity: >95% as determined by SDS PAGE and RP-HPLC Amino acid sequence: MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT…

  • ROCHE 5-Bromo-2'-deoxy-uridine Labeling and Detection Kit III


    …96-well microplate dilute 100 μl anti-BrdU-peroxidase, Fab fragments, stock solution, with 9.9 ml PBS and BSA (final concentration: 200 mU/ml)]. Peroxidase substrate Dissolve the ABTS powder in substrate buffer and stir at 15 to 25 °C to obtain a clear solution. Peroxidase substrate…

  • Amido black


    …Buffalo Black NBR Refractive index: n 20 D 1.77 (Predicted) Appearance: Dark red to black powder Density: 1.05 g/mL at 20°C HS Code: 3204.12 IUPAC_Name: disodium (6Z)-4-amino-3-(4-nitrophenyl)diazenyl-5-oxo-6-(phenylhydrazinylidene)naphthalene-2,7-disulfonate…

Compare Tool

Select up to 3 products

Please Log In

Don't have an Account? Create one now.