Acid Distillation System

Compare Tool

Select up to 3 products

Acid Distillation System
1 - 30 of 30
Sort
View
Show



  • …volatile acids, cyanides and alcohol content. UDK 129 far exceeds expectations from an entry-level distillation unit: Automated Operation System runs after setting sodium hydroxide addition and distillation time High Tech No loss of nitrogen: distillate

  • The completely automatic Kjeldahl distillation and titration system offers great performance and the maximum in terms of safety for the user. Automatic addition of all the reagents involved (sodium hydroxide, water, boric acid, titrant solution) with low level warning simplifies the routine…

  • WaterPro® BT System produces both RO-purified and Type I water packaged in a compact all-inone benchtop design For laboratories needing 1-10 liters per day, the WaterPro BT System, delivers ultrapure Type I*, up to 18.2 megohm-cm at a typical rate of >0.5 liter per minute** at inlet…

  • …operation in Thermo Scientific Barnstead water purification system storage reservoirs. The LabStrong Ventguard Filter protects pure water during storage by preventing airborne impurities such as organic vapors, carbon dioxide, alkali and acid gases from entering the water storage reservoir. The…

  • …corrosive and toxic fumes produced during oxidative mineralizations or similar processes. Complete System Condensation in a water trap Neutralization with acids or bases Optional absorption with activated carbon Ideal for high fume levels such as with soybean analysis…

  • Aquatron® Water Stills

    Stuart (Cole-Parmer)

    …litres/hour double distilled water for higher purity levels. The first stage distillation is carried out in a glassware set mounted at the front of the cabinet allowing easy access for descaling. The distilled water is fed to a second set of glassware mounted at the rear and distilled a second time.…

  • IWT Ionxchangers

    Evoqua Water Technologies

    …resin by color change High capacity compared to many other disposables - up to 1800 grains High flow rates up to 7.2 GPH Single or triple distillation water quality Transparent cylinders allow for easy detection of exhausted resin by color change. No need for costly conductivity meters. These…

  • …self-polycondensation of 4-(4′-phenoxyphenoxy)benzoic acids.. 1,3-1H-dibenzimidazole-benzene by the reaction of isophthalic acid with 1,2-diaminobenzene. Application: Phosphorus pentachloride has been used for the vaccum distillation of 1-methyl-2-pyrrolidinone (NMP), which was employed as…

  • …preparation of 1, 5-benzodiazepine analogs. P2O5/KX (X = Br, I) reagent system may be used for the transformation of alcohols into the corresponding alkyl iodides and bromides. Application: Phosphorus pentoxide/methanesulfonic acid (PPMA) may be used as a condensing agent and solvent for the…

  • …by acid and alkaline vapors, moisture, etc., entrained during evacuation of distilling apparatus, vacuum desiccators, etc. Freezing trap, when immersed in suitable freezing mixture, removes condensable vapors, gauge liquid or other foreign material accidentally introduced into the system

  • …environment; for faster, more reproducible analyses. The Touch Apps software supports the following analyses: FAME (Fatty Acid Methyl Esters) in middle distillate fuels, according to EN 140878 (2009), with the Frontier Benzene in spark-ignition fuels, according to ASTM D6277 (2007), with…

  • …(Fatty Acid Methyl Esters) in middle distillate fuels, according to EN 140878 (2009), with the Frontier Benzene in spark-ignition fuels, according to ASTM D6277 (2007), with the Spectrum Two or Frontier With this system, SOPs are provided for clear instructions for day-to-day use of the system.

  • Sidearm Flask 10ml

    DWK Life Sciences (Kimble)

    …incubations, insulin bio-assays, persulfate oxidations, and the “distillation” of any volatile acid or base. Since either an acid or alkali is introduced at the end of the reaction, it is possible to use this easy system with either a phosphate or bicarbonate buffer The…

  • Center Well Pk144

    DWK Life Sciences (Kimble)

    …incubations, insulin bio-assays, persulfate oxidations, and the “distillation” of any volatile acid or base. Since either an acid or alkali is introduced at the end of the reaction, it is possible to use this easy system with either a phosphate or bicarbonate buffer The…

  • Flask Erlenmeyer 10ml

    DWK Life Sciences (Kimble)

    …incubations, insulin bio-assays, persulfate oxidations, and the “distillation” of any volatile acid or base. Since either an acid or alkali is introduced at the end of the reaction, it is possible to use this easy system with either a phosphate or bicarbonate buffer The…

  • Glycol CHEMets Kit

    CHEMetrics

    …than the standard chromotropic acid procedure. Shelf-life: five months. We recommend stocking quantities that will be used within four months. Kit comes in a plastic case and contains everything needed to perform 30 tests (except distilled water): Refill, Comparator, Activator…

  • …nutrients, inorganic salts provide ions required for the metabolism. Glycerol serves as essential fatty acids for the multiplication of Mycobacteria and the media has strong buffering system (4). Polysorbate 80 (Tween 80) acts as surfactant facilitating the even distribution of two phases and…

  • …positive pressure system. Nutritional needs of normal mammalian fibroblasts and certain HeLa cell subtypes could not be met by Eagle’s earlier medium Basal Medium Eagle (BME). This led to the development of MEM incorporating specific modifications such as higher amino acid concentrations…

  • FD Rapid MultiStain™ Kit

    FD NeuroTechnologies

    …Solution, 250mL  Acetic Acid Solution, 250mL  Resinous mounting medium, 6mL  Cover glass forceps (1)  Disposable Pasteur Pipets (5) Rubber bulb (1)  User Manual  Materials required but not included: Double distilled or deionized…

  • …tissues. Background: CTLA-4(Cytotoxic T-Lymphocyte Antigen 4), also known as CD152, is a protein receptor that down regulates the immune system. It is a member of the immunoglobulin superfamily, which is expressed on the surface of Helper T cells and transmits an inhibitory signal to T cells.…

  • …sku : A00101 name : Anti-IL-1 beta/IL1B Picoband™ Antibody gene_name : IL1B clonality : Polyclonal concentration : Add 0.2ml of distilled water will yield a concentration of 500ug/ml. contents : Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. size :…

  • …50mg/l chloramphenicol along with 5-10% sterile defibrinated blood is often recommended for inhibition of bacteria and isolation of pathogenic systemic fungi. A mixture of cycloheximide (0.5 g/l) and chloramphenicol (0.05 g/l) is also used for selective isolation of pathogenic fungi (incubation…

  • …caseinate as nitrogen source. Asparagine in addition to being an amino acid is also a source of nitrogen. Sodium propionate is used as a substrate in anaerobic fermentation. Dipotassium phosphate provides the buffering system. The sulphates serve as source of sulphur and metallic ions. Glycerol…

  • …decomposition of organic matter but readily oxidizes to form nitrate. These processes occur in wastewater treatment plants, water distribution systems, and natural waters. Nitrites are useful as corrosion inhibitors, preservatives, pigments, and in manufacturing many organic preservative chemicals.…

  • …the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner…

  • …mouse TNF alpha (202-235aa FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL), different from the related human sequence by five amino acids, and from the related rat sequence by three amino acids. form : Lyophilized purification : Immunogen affinity purified. storage : At -20°C for one year. After…

  • …aspirates. • Lyse red blood cells and stabilize total nucleic acids with RNA/DNA Stabilization Reagent for Blood/Bone Marrow (separate reagent, not contained in the kit). • Bind total nucleic acids to Magnetic Glass Particles and collect by centrifugation. • Wash…

  • … sku : A00005 name : Anti-BRCA1 Picoband™ Antibody gene_name : BRCA1 clonality : Polyclonal concentration : Add 0.2ml of distilled water will yield a concentration of 500ug/ml. contents : Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. size…

  • …sulfide production, thereby aiding in the differentiation process due to the formation of black centered colonies. The indicator system, consisting of acid fuchsin and bromothymol blue, has lower toxicity as compared to other enteric media, resulting in improved recovery of enteric pathogens.…

  • ROCHE EPO ELISA

    MilliporeSigma

    …hematopoietic cytokine superfamily. It has structural similarity to growth hormone and is encoded as a 193 amino acid polypeptide comprising of canonical leader sequence composed of 27 amino acid, and a carboxyl terminal arginine which is removed by posttranslational cleavage. Furthermore, Epo is…

Compare Tool

Select up to 3 products

Please Log In

Don't have a web profile? Create one now.