1x Pbs

Compare Tool

Select up to 3 products

1x Pbs
1 - 32 of 43
  • 1X PBS, pH 7.2

    Quality Biological

    PBS (phosphate buffered saline) is a balanced salt solution used for a variety biological and cell culture applications, such as washing cells before dissociation, transporting cells or tissue, diluting cells for counting, and preparing reagents. Endotoxin and Mycoplasma tested Applications …

  • 1X PBS, pH 7.4

    Quality Biological

    PBS (phosphate buffered saline) is a balanced salt solution used for a variety biological and cell culture applications, such as washing cells before dissociation, transporting cells or tissue, diluting cells for counting, and preparing reagents. Endotoxin and Mycoplasma tested Applications …

  • 1X PBS (Phosphate Buffered Saline)


    …procedures, such as washing and transporting cells or tissue samples, diluting cell for counting and general preparation of reagents. PBS contains no Ca or Mg ions to provide efficient washing of chelators. Sold in 1X concentration to suit a variety of working dilution for any biological need.

  • PBS 1X Solution

    RPI (Research Products International)

    …Saline is a buffer solution commonly used in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. These uses include substance dilution and cell container rinsing. Ready to use sterile 1X solution. Ingredients: Sodium Chloride: 137 mM …

  • PBS (Phosphate Buffered Saline), 1X


    Ultra pure Phosphate buffered isotonic saline. Without calcium and magnesium. Sterile filtered. 1X PBS solutions contains 137mM NaCl, 2.7mM KCl, 10mM Na2HPO4, 2mM KH2PO4.

  • PBS, 1X Solution, 1.5mL Pre-Filled Tubes

    RPI (Research Products International)

    …in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. Uses include substance dilution and cell container rinsing. Ready to use sterile 1X solution, supplied in sterile pre-filled screw cap tubes. Each tube contains 1.5ml PBS 1X solution, packaged in a…

  • Phosphate-buffered saline (PBS, 1X), sterile

    Alfa Aesar

    Harmonized Tariff Code:  3822.00

  • PBS Tablets

    RPI (Research Products International)

    Phosphate Buffered Saline is a buffer solution commonly used in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. These uses include substance dilution and cell container rinsing. Add one tablet per 100ml of purified water for a 1X solution of PBS.

  • DPBS 1X Solution

    RPI (Research Products International)

    Ready to use sterile 1x solution Contains: 137 mM Sodium Chloride 2.7 mM Potassium Chloride 10 mM Phosphates Does not contain Calcium or Magnesium

  • PBS with Calcium and Magnesium


    Washing buffer for peroxidase conjugates in Western Blotting. 1X PBS with Ca++ and Mg++ pH 7.4 0.1 (25°C)

  • PBS 1X Sterile Solution pH 7.4


    Grade: Biotechnology

  • PBS (Phosphate Buffered Saline)


    PBS (Phosphate Buffered Saline) Ready-to-use solutions, available in 1X and 10X concentrated solutions. Features 1X: 8mM NaH2PO4,150mM NaCl, 3mM KCl, 2mM KH2PO4(pH 7.4) 10X: 80mM NaH2PO4 1.5M NaCl, 30mM KCl, 20mM…

  • PBS [10X] (Phosphate Buffered Saline)


    PBS (Phosphate Buffered Saline) Ready-to-use solutions, available in 1X and 10X concentrated solutions. Features 1X:  8mM NaH2PO4, 150mM NaCl, 3mM KCl, 2mM KH2PO4 (pH 7.4) 10X: 80mM NaH2PO4 1.5M NaCl,…

  • PBS (Phosphate Buffered Saline) Tablets

    Bio Basic Inc.

    One tablet dissolved in 100ml of deionized water yields 1 X PBS buffer. The final 1X solution contains: 2.7 mM potassium chloride, 137 mM sodium chloride and 10 mM Phosphate Buffer, pH: 7.3-7.5 at 25°C (1 Tablet in 100ml water).

  • PBS Blocking Buffer with BSA

    Bio Basic Inc.

    PBS Blocking Buffer with BSA Premixed Powder is used for immunodetection assays such as Western blots, dot blots and ELISA. 1 pack will make 1 liter of 1X stremgth blocking solution contain 3% BSA.

  • 20X PBS (Phosphate Buffered Saline)


    …procedures, such as washing and transporting cells or tissue samples, diluting cell for counting and general preparation of reagents. PBS contains no Ca or Mg ions to provide efficient washing of chelators. Sold in 1X concentration to suit a variety of working dilution for any biological need.

  • JAW™ Modified Dulbecco's PBS Packs (for ELISA and Western Blots)


    …solution [1X] with pH 7.4 Come in convenient ready to use packs with no weighing or adjusting of pH required. These buffer packs have a longer shelf life when compared to the buffer solutions Highly reproducible better compositions Application(s) : Modified Dulbecco's PBS Packs…

  • Phosphate Buffer Saline (PBS)

    Electron Microscopy Sciences

    PBS is commonly used in biochemistry. It is a salty solution containing calcium chloride, sodium phosphate and potassium phosphate. PBS is isotonic and non-toxic to cells. 1X PBS final concentration is 0.137M NaCl, 0.01M Na2HPO4, 0.0027M KCl and pH 7.4.

  • Nuclear and Cytoplasmic Protein Extraction Kit


    …of 20uL packed cell pellets or 50 preparations of 100uL cell pellets (~10g cell paste total). Kit Contents 40mL Cytoplasmic Extraction Buffer (CEB) 3mL Nuclear Extraction Buffer (NEB) 300µL Extraction Buffer Additive (EBA) – 200X solution 100mL 1X PBS (pH 7.2)

  • Anti-TRIM14 antibody produced in rabbit, affinity isolated antibody


    … Synthetic peptide directed towards the N terminal region of human TRIM14 Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Sequence: Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV

  • RAGE human, recombinant, expressed in human cells, >=95% (SDS-PAGE), >=95% (HPLC…


    …mum filtered solution of 20 mM PB and 150 mM NaCl, pH7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). After adding 1x PBS, let the tube stand at room temperature for 3 minutes to allow lyophilized protein to dissolve.…

  • Phosphate Buffered Saline (PBS), 1X, Sterile


  • JAW Dry Powder Buffer Packs


    …Carbonate-Bicarbonate buffer, pH 9.4. JAW™ Phosphate Buffered Saline (PBS) packs [1X] make 1L of 2.7mM potassium chloride, 137mM sodium chloride and 10mM phosphate buffer (pH 7.3-7.5). JAW™ Phosphate Buffered Saline (PBS) packs [10X] make 1L of 43mM NaH2PO4,1.37M NaCl,…

  • SIGMA Phosphate buffered saline, 10x concentrate, BioReagent, suitable for cell…


    Synonyms: PBS Other Notes: When diluted to a 1X concentration, this product will yield a phosphate buffered saline solution with a phosphate buffer concentration of 0.01M and a sodium chloride concentration of 0.154M. The solution pH will be 7.4. Packaging: 4L package size comes in a box with…

  • ProBDNF human, recombinant, expressed in E. coli, >=95% (SDS-PAGE), >=95% (HPLC)


    …in the brain. Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM PB and 250 mM NaCl, pH 7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • ProNGF human, recombinant, expressed in E. coli, >=95% (SDS-PAGE), >=95% (HPLC)


    …neurodegeneration. Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM PB and 250 mM NaCl, pH 7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • Granzyme A human, recombinant, expressed in mammalian cells, >=95% (SDS-PAGE), >…


    …(residues 29-262). Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM MES and150 mM NaCl, pH 5.5. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • ProNT-3 human, recombinant, expressed in mammalian cells, >=95% (SDS-PAGE), >=95…


    …mechanism. Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM PB and 250 mM NaCl, pH 7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • Casein blocking buffer w/ Fish gelatin for ELISA [10X]


    …antibodies and is suitable for ELISA assays. Blocking buffer is supplied in a 10X concentration of physiological saline buffer. Technical Information: Includes 3 X 30 mL, 10X concentrate Prepares 900ml of working solution 1X working solution contains: 1% casein, 0.45% fish gelatin in PBS

  • EcoCRM™ Diptheria Toxin CRM197 Mutant Vaccine Carrier Protein

    IBT Bioservices

    …coli. Supplied by: Fina Biosolutions LLC Size: 1 mg of protein is supplied at a concentration of 1.0 mg/mL (by absorbance at 280 nm) in 1X PBS, pH 7.6, 10% glycerol. The theoretical molecular weight of the protein is 58.4 kDa. Purity: >95% by HPLC OD260/OD280

  • ROCHE Anti-HA-Biotin, from mouse IgG2bK


    …be taken as a guideline: • Western blot: 1 to 10 μg/ml Working solution: 20-fold dilution of Western Blocking Reagent in 1x PBS. Do not use sodium azide! Specificity: The antibody reacts with the HA epitope, a nonapeptide sequence (YPYDVPDYA) derived from the influenza…

  • Immobilized Monomeric Avidin


    …as opposed to Kd=10 -15 for native avidin. This lower binding affinity allows elution of molecules with mild elution buffers (2mM D-Biotin in 1X PBS), as opposed to the strong denaturing buffers (8M Guanidine•HCl, pH 1.5) used with native avidin. The covalent attachment of monomeric…

Compare Tool

Select up to 3 products

Please Log In

Don't have an Account? Create one now.