1x Pbs

Compare Tool

Select up to 3 products

1x Pbs
1 - 32 of 32
Sort
View
Show
  • 1X PBS, pH 7.4

    Quality Biological

    PBS (phosphate buffered saline) is a balanced salt solution used for a variety biological and cell culture applications, such as washing cells before dissociation, transporting cells or tissue, diluting cells for counting, and preparing reagents. Endotoxin and Mycoplasma tested Applications …

  • PBS 1X Solution

    RPI (Research Products International)

    …Saline is a buffer solution commonly used in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. These uses include substance dilution and cell container rinsing. Ready to use sterile 1X solution. Ingredients: Sodium Chloride: 137 mM …

  • Phosphate-buffered saline (PBS, 1X), sterile

    Alfa Aesar

    Harmonized Tariff Code:  3822.00

  • PBS, 1X Solution, 1.5mL Pre-Filled Tubes

    RPI (Research Products International)

    …in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. Uses include substance dilution and cell container rinsing. Ready to use sterile 1X solution, supplied in sterile pre-filled screw cap tubes. Each tube contains 1.5ml PBS 1X solution, packaged in a…

  • PBS (Phosphate Buffered Saline) Tablets

    Bio Basic Inc.

    One tablet dissolved in 100ml of deionized water yields 1 X PBS buffer. The final 1X solution contains: 2.7 mM potassium chloride, 137 mM sodium chloride and 10 mM Phosphate Buffer, pH: 7.3-7.5 at 25°C (1 Tablet in 100ml water).

  • EcoCRM™ Diptheria Toxin CRM197 Mutant Vaccine Carrier Protein

    IBT Bioservices

    …coli. Supplied by: Fina Biosolutions LLC Size: 1 mg of protein is supplied at a concentration of 1.0 mg/mL (by absorbance at 280 nm) in 1X PBS, pH 7.6, 10% glycerol. The theoretical molecular weight of the protein is 58.4 kDa. Purity: >95% by HPLC OD260/OD280

  • SIGMA Phosphate buffered saline, 10x concentrate, BioReagent, suitable for cell…

    MilliporeSigma

    Synonyms: PBS Other Notes: When diluted to a 1X concentration, this product will yield a phosphate buffered saline solution with a phosphate buffer concentration of 0.01M and a sodium chloride concentration of 0.154M. The solution pH will be 7.4. Packaging: 4L package size comes in a box with…

  • 1X PBS, pH 7.2

    Quality Biological

    PBS (phosphate buffered saline) is a balanced salt solution used for a variety biological and cell culture applications, such as washing cells before dissociation, transporting cells or tissue, diluting cells for counting, and preparing reagents. Endotoxin and Mycoplasma tested Applications …

  • Protein-A Red Separopore®(Agarose)4B

    bioWORLD

    … Wash pellet 4 times with 1.0 ml RIPA buffer (more stringent) or PBS (less stringent), each time repeating centrifugation step above. After final wash, aspirate and discard supernatant and resuspend pellet in 40 μl of 1x electrophoresis sample buffer. Boil samples for 2minutes and analyze…

  • PBS Blocking Buffer with BSA

    Bio Basic Inc.

    PBS Blocking Buffer with BSA Premixed Powder is used for immunodetection assays such as Western blots, dot blots and ELISA. 1 pack will make 1 liter of 1X stremgth blocking solution contain 3% BSA.

  • PBS 1X Sterile Solution pH 7.4

    Amresco

    Grade: Biotechnology

  • PBS with Calcium and Magnesium

    bioWORLD

    Washing buffer for peroxidase conjugates in Western Blotting. 1X PBS with Ca++ and Mg++ pH 7.4 0.1 (25°C)

  • Nuclear and Cytoplasmic Protein Extraction Kit

    bioWORLD

    …of 20uL packed cell pellets or 50 preparations of 100uL cell pellets (~10g cell paste total). Kit Contents 40mL Cytoplasmic Extraction Buffer (CEB) 3mL Nuclear Extraction Buffer (NEB) 300µL Extraction Buffer Additive (EBA) – 200X solution 100mL 1X PBS (pH 7.2)

  • Anti-TRIM14 antibody produced in rabbit, affinity isolated antibody

    MilliporeSigma

    … Synthetic peptide directed towards the N terminal region of human TRIM14 Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Sequence: Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV

  • Casein blocking buffer w/ Fish gelatin for ELISA [10X]

    bioWORLD

    …antibodies and is suitable for ELISA assays. Blocking buffer is supplied in a 10X concentration of physiological saline buffer. Technical Information: Includes 3 X 30 mL, 10X concentrate Prepares 900ml of working solution 1X working solution contains: 1% casein, 0.45% fish gelatin in PBS

  • BetterBlocker Universal Blocking Solution (10X Reagent)

    bioWORLD

    …immunohistochemistry, immunocytochemistry, and ELISA assays. BetterBlockerTM-I contains Hammarsten grade casein in PBS (pH 7.4), Tween 20 (0.01% in 1X) and sodium azide preservative. Dilute to 1X working solution with purified water. To use as a blocking buffer, cover surface area completely with…

  • Protein-A Separopore® 4B

    bioWORLD

    … Wash pellet 4 times with 1.0 ml RIPA buffer (more stringent) or PBS (less stringent), each time repeating centrifugation step above. After final wash, aspirate and discard supernatant and resuspend pellet in 40 µl of 1x electrophoresis sample buffer. Boil samples for 2minutes and analyze…

  • SIGMA Dulbecco's Phosphate Buffered Saline, Modified, without calcium chloride…

    MilliporeSigma

    Synonym(s): DPBS Application: Dulbecco’s Phosphate Buffered Saline 10X is a stock solution used to prepare 1X D-PBS in cell culture grade water (W3500). D-PBS is used to wash cells during preparation and serial transfer.

  • PBS (Phosphate Buffered Saline), 1X, pH 7.4

    Growcells

    …and transporting cells or tissue samples, diluting cell for counting and general preparation of reagents. PBS contains no Ca or Mg ions to provide efficient washing of chelators. Sold in 1X concentration to suit a variety of working dilution for any biological need. Recipe: Sodium…

  • Phosphate Buffered Saline (PBS), 1X, Sterile

    Amresco

  • PBS Tablets

    RPI (Research Products International)

    Phosphate Buffered Saline is a buffer solution commonly used in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. These uses include substance dilution and cell container rinsing. Add one tablet per 100ml of purified water for a 1X solution of PBS.

  • DPBS 1X Solution

    RPI (Research Products International)

    Ready to use sterile 1x solution Contains: 137 mM Sodium Chloride 2.7 mM Potassium Chloride 10 mM Phosphates Does not contain Calcium or Magnesium

  • Phosphate Buffer Saline (PBS)

    Electron Microscopy Sciences

    PBS is commonly used in biochemistry. It is a salty solution containing calcium chloride, sodium phosphate and potassium phosphate. PBS is isotonic and non-toxic to cells. 1X PBS final concentration is 0.137M NaCl, 0.01M Na2HPO4, 0.0027M KCl and pH 7.4.

  • RAGE human, recombinant, expressed in human cells, >=95% (SDS-PAGE), >=95% (HPLC…

    MilliporeSigma

    …mum filtered solution of 20 mM PB and 150 mM NaCl, pH7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). After adding 1x PBS, let the tube stand at room temperature for 3 minutes to allow lyophilized protein to dissolve.…

  • ProNGF human, recombinant, expressed in E. coli, >=95% (SDS-PAGE), >=95% (HPLC)

    MilliporeSigma

    …neurodegeneration. Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM PB and 250 mM NaCl, pH 7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • Granzyme A human, recombinant, expressed in mammalian cells, >=95% (SDS-PAGE), >…

    MilliporeSigma

    …(residues 29-262). Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM MES and150 mM NaCl, pH 5.5. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • ProBDNF human, recombinant, expressed in E. coli, >=95% (SDS-PAGE), >=95% (HPLC)

    MilliporeSigma

    …in the brain. Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM PB and 250 mM NaCl, pH 7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • ProNT-3 human, recombinant, expressed in mammalian cells, >=95% (SDS-PAGE), >=95…

    MilliporeSigma

    …mechanism. Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM PB and 250 mM NaCl, pH 7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • Accumax(TM) solution, sterile-filtered, suitable for cell culture

    MilliporeSigma

    …of proteolytic and collagenolytic enzymes. Each bottle has 100 mL of 1x Accumax enzymes in Dulbecco's PBS. There are no mammalian or bacterial-derived products found in Accumax. Formula variant: Prepared in Dulbecco's PBS (0.2 g/L KCl, 0.2 g/L KH2PO4, 8 g/L NaCl, and 1.15 g/L Na2HPO4). Refer…

  • Phosphate Buffered Saline

    bioWORLD

    Each Ready-Pack prepares 1L of 10X concentrate. A 1X solution is prepared by dissolving 8.6g in 1L distilled water. Sufficient dry powder is supplied to prepare 10L of 1X Solution. Packaged as 1 x 1L, 2 x 1L or 5 x 1L packs Ultra Pure Grade, Powder Blend pH (9.88 g/L, water): 7.4 …

  • Stripping Buffer

    bioWORLD

    Product contains enough liquid concentrate to make 1L of 1X solution. To use this product, dilute it 4 fold with DI water and add 0.6% beta ME. Wash membrane in this buffer and incubate at 65°C for 30 minutes under constant agitation. Wash the membrane 5X for 5 min in PBS-Tween20 or TBS-Tween20.…

  • Dulbecco's Phosphate Buffered Saline, 10X (without Calcium & Magnesium)

    MP Biomedicals

    Dulbecco’s Phosphate Buffered Saline 10X is a stock solution used to prepare 1X D-PBS in cell culture grade water. D-PBS is used to wash cells during preparation and serial transfer Phosphate buffering maintains the pH in the physiological range. Calcium and magnesium facilitate cell binding…

Compare Tool

Select up to 3 products

Please Log In

Don't have an Account? Create one now.