1x Pbs

Compare Tool

Select up to 3 products

1x Pbs
1 - 32 of 52
Sort
View
Show
  • 1X PBS, pH 7.4

    Quality Biological

    PBS (phosphate buffered saline) is a balanced salt solution used for a variety biological and cell culture applications, such as washing cells before dissociation, transporting cells or tissue, diluting cells for counting, and preparing reagents. Endotoxin and Mycoplasma tested Applications …

  • 1X PBS, pH 7.2

    Quality Biological

    PBS (phosphate buffered saline) is a balanced salt solution used for a variety biological and cell culture applications, such as washing cells before dissociation, transporting cells or tissue, diluting cells for counting, and preparing reagents. Endotoxin and Mycoplasma tested Applications …

  • 1X PBS (Phosphate Buffered Saline)

    Growcells

    …procedures, such as washing and transporting cells or tissue samples, diluting cell for counting and general preparation of reagents. PBS contains no Ca or Mg ions to provide efficient washing of chelators. Sold in 1X concentration to suit a variety of working dilution for any biological need.

  • Endotoxin-Free Dulbecco’s PBS (1X) (w/o Ca++ & Mg++)

    MilliporeSigma

    … Shipped In: Ambient Storage Conditions: Store at room temperature until expiration date. Application Endotoxin-Free Dulbecco’s PBS (1X) (w/o Ca++ & Mg++) is sterile filtered through a 0.1 micron filter and is considered endotoxin-free (<0.005 EU/ml). Quality Assurance…

  • PBS 1X Solution

    RPI (Research Products International)

    …Saline is a buffer solution commonly used in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. These uses include substance dilution and cell container rinsing. Ready to use sterile 1X solution. Ingredients: Sodium Chloride: 137 mM …

  • QuickSilver™ PBS and PBST Powdered Buffer Packs

    Accuris Instruments

    …life QuickSilver™ PBS and PBST Because its osmolality and ion concentration closely mimic that of the human body, PBS is commonly used for cell culture applications, as well as HPLC and MS. PBST is a wash buffer and diluent for ELISA. The 1X PBS solution contains 137mN NaCl, 2.7mM…

  • PBS (Phosphate Buffered Saline), 1X

    Crystalgen

    Ultra pure Phosphate buffered isotonic saline. Without calcium and magnesium. Sterile filtered. 1X PBS solutions contains 137mM NaCl, 2.7mM KCl, 10mM Na2HPO4, 2mM KH2PO4.

  • DPBS 1X Solution

    RPI (Research Products International)

    Ready to use sterile 1x solution Contains: 137 mM Sodium Chloride 2.7 mM Potassium Chloride 10 mM Phosphates Does not contain Calcium or Magnesium

  • Phosphate Buffer Saline (PBS)

    Electron Microscopy Sciences

    PBS is commonly used in biochemistry. It is a salty solution containing calcium chloride, sodium phosphate and potassium phosphate. PBS is isotonic and non-toxic to cells. 1X PBS final concentration is 0.137M NaCl, 0.01M Na2HPO4, 0.0027M KCl and pH 7.4.

  • Phosphate-buffered saline (PBS, 1X), sterile

    Alfa Aesar

    Harmonized Tariff Code:  3822.00

  • JAW™ Modified Dulbecco's PBS Packs (for ELISA and Western Blots)

    G-Biosciences

    …solution [1X] with pH 7.4 Come in convenient ready to use packs with no weighing or adjusting of pH required. These buffer packs have a longer shelf life when compared to the buffer solutions Highly reproducible better compositions Application(s) : Modified Dulbecco's PBS Packs…

  • PBS (Phosphate Buffered Saline)

    G-Biosciences

    PBS (Phosphate Buffered Saline) Ready-to-use solutions, available in 1X and 10X concentrated solutions. Features 1X: 8mM NaH2PO4,150mM NaCl, 3mM KCl, 2mM KH2PO4(pH 7.4) 10X: 80mM NaH2PO4 1.5M NaCl, 30mM KCl, 20mM…

  • Granzyme A human, recombinant, expressed in mammalian cells, >=95% (SDS-PAGE), >…

    MilliporeSigma

    …(residues 29-262). Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM MES and150 mM NaCl, pH 5.5. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • Nuclear and Cytoplasmic Protein Extraction Kit

    bioWORLD

    …of 20uL packed cell pellets or 50 preparations of 100uL cell pellets (~10g cell paste total). Kit Contents 40mL Cytoplasmic Extraction Buffer (CEB) 3mL Nuclear Extraction Buffer (NEB) 300µL Extraction Buffer Additive (EBA) – 200X solution 100mL 1X PBS (pH 7.2)

  • SIGMA Phosphate buffered saline, 10x concentrate, BioReagent, suitable for cell…

    MilliporeSigma

    Synonyms: PBS Other Notes: When diluted to a 1X concentration, this product will yield a phosphate buffered saline solution with a phosphate buffer concentration of 0.01M and a sodium chloride concentration of 0.154M. The solution pH will be 7.4. Packaging: 4L package size comes in a box with…

  • AccuGENETM 1X PBS

    Lonza

    …buffered saline is a buffer solution commonly used in biological research. It is a water-based salt solution containing disodium hydrogen phosphate and sodium chloride. The osmolarity and ion concentrations of PBS are isotonic, so it is often used for protein and cell culture applications.

  • PBS, 1X Solution, 1.5mL Pre-Filled Tubes

    RPI (Research Products International)

    …in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. Uses include substance dilution and cell container rinsing. Ready to use sterile 1X solution, supplied in sterile pre-filled screw cap tubes. Each tube contains 1.5ml PBS 1X solution, packaged in a…

  • PBS (1X), 6.7mM PO4, without Calcium and Magnesium

    Lonza

    Phosphate Buffered Saline serves as a wash solution in a wide variety of laboratory applications.

  • PBS (1X), 6.7mM PO4, without Calcium and Magnesium

    Lonza

    Phosphate Buffered Saline serves as a wash solution in a wide variety of laboratory applications.

  • PBS (1X), 6.7mM PO4, without Calcium and Magnesium

    Lonza

    Phosphate Buffered Saline serves as a wash solution in a wide variety of laboratory applications.

  • PBS (1X), 6.7mM PO4, without Calcium and Magnesium

    Lonza

    Phosphate Buffered Saline serves as a wash solution in a wide variety of laboratory applications.

  • PBS (1X), 6.7mM PO4, without Calcium and Magnesium

    Lonza

    Phosphate Buffered Saline serves as a wash solution in a wide variety of laboratory applications.

  • PBS Tablets

    RPI (Research Products International)

    Phosphate Buffered Saline is a buffer solution commonly used in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. These uses include substance dilution and cell container rinsing. Add one tablet per 100ml of purified water for a 1X solution of PBS.

  • PBS with Calcium and Magnesium

    bioWORLD

    Washing buffer for peroxidase conjugates in Western Blotting. 1X PBS with Ca++ and Mg++ pH 7.4 0.1 (25°C)

  • PBS [10X] (Phosphate Buffered Saline)

    G-Biosciences

    PBS (Phosphate Buffered Saline) Ready-to-use solutions, available in 1X and 10X concentrated solutions. Features 1X:  8mM NaH2PO4, 150mM NaCl, 3mM KCl, 2mM KH2PO4 (pH 7.4) 10X: 80mM NaH2PO4 1.5M NaCl,…

  • PBS (Phosphate Buffered Saline) Tablets

    Bio Basic Inc.

    One tablet dissolved in 100ml of deionized water yields 1 X PBS buffer. The final 1X solution contains: 2.7 mM potassium chloride, 137 mM sodium chloride and 10 mM Phosphate Buffer, pH: 7.3-7.5 at 25°C (1 Tablet in 100ml water).

  • PBS Blocking Buffer with BSA

    Bio Basic Inc.

    PBS Blocking Buffer with BSA Premixed Powder is used for immunodetection assays such as Western blots, dot blots and ELISA. 1 pack will make 1 liter of 1X stremgth blocking solution contain 3% BSA.

  • 20X PBS (Phosphate Buffered Saline)

    Growcells

    …procedures, such as washing and transporting cells or tissue samples, diluting cell for counting and general preparation of reagents. PBS contains no Ca or Mg ions to provide efficient washing of chelators. Sold in 1X concentration to suit a variety of working dilution for any biological need.

  • Anti-TRIM14 antibody produced in rabbit, affinity isolated antibody

    MilliporeSigma

    … Synthetic peptide directed towards the N terminal region of human TRIM14 Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Sequence: Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV

  • RAGE human, recombinant, expressed in human cells, >=95% (SDS-PAGE), >=95% (HPLC…

    MilliporeSigma

    …mum filtered solution of 20 mM PB and 150 mM NaCl, pH7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). After adding 1x PBS, let the tube stand at room temperature for 3 minutes to allow lyophilized protein to dissolve.…

  • JAW Dry Powder Buffer Packs

    G-Biosciences

    …Carbonate-Bicarbonate buffer, pH 9.4. JAW™ Phosphate Buffered Saline (PBS) packs [1X] make 1L of 2.7mM potassium chloride, 137mM sodium chloride and 10mM phosphate buffer (pH 7.3-7.5). JAW™ Phosphate Buffered Saline (PBS) packs [10X] make 1L of 43mM NaH2PO4,1.37M NaCl,…

Compare Tool

Select up to 3 products

Please Log In

Don't have a web profile? Create one now.