1x Pbs

Compare Tool

Select up to 3 products

1x Pbs
1 - 32 of 55
  • 1X PBS, pH 7.2

    Quality Biological

    PBS (phosphate buffered saline) is a balanced salt solution used for a variety biological and cell culture applications, such as washing cells before dissociation, transporting cells or tissue, diluting cells for counting, and preparing reagents. Endotoxin and Mycoplasma tested Applications …

  • 1X PBS, pH 7.4

    Quality Biological

    PBS (phosphate buffered saline) is a balanced salt solution used for a variety biological and cell culture applications, such as washing cells before dissociation, transporting cells or tissue, diluting cells for counting, and preparing reagents. Endotoxin and Mycoplasma tested Applications …

  • Harmonized Tariff Code:  3822.00

  • Phosphate Buffered Saline serves as a wash solution in a wide variety of laboratory applications.

  • 1X PBS


    PBS, phosphate buffered saline, is an isotonic solution used in molecular biology, cell culture, protein chemistry, and biochemical applications. PBS is nontoxic to cells and has similar osmolarity and ion concentrations as the human body. pH 7.4 is most commonly used with cell culture. …

  • Phosphate Buffered Saline

    Intermountain Life Sciences

    Phosphate-buffered saline (PBS) 1X, pH 7.2 is a physiological salt solution commonly found in many cell culture applications. PBS is isotonic and nontoxic to cells. ILS offers PBS that is sterile with endotoxin levels tested for each lot. Our PBS is manufactured utilizing USP raw materials…

  • … Shipped In: Ambient Storage Conditions: Store at room temperature until expiration date. Application Endotoxin-Free Dulbecco’s PBS (1X) (w/o Ca++ & Mg++) is sterile filtered through a 0.1 micron filter and is considered endotoxin-free (<0.005 EU/ml). Quality Assurance…

  • …buffered saline is a buffer solution commonly used in biological research. It is a water-based salt solution containing disodium hydrogen phosphate and sodium chloride. The osmolarity and ion concentrations of PBS are isotonic, so it is often used for protein and cell culture applications.

  • PBS 1X Solution

    RPI (Research Products International)

    …Saline is a buffer solution commonly used in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. These uses include substance dilution and cell container rinsing. Ready to use sterile 1X solution. Ingredients: Sodium Chloride: 137 mM …

  • Phosphate Buffered Saline serves as a wash solution in a wide variety of laboratory applications.

  • DPBS 1X Solution

    RPI (Research Products International)

    Ready to use sterile 1x solution Contains: 137 mM Sodium Chloride 2.7 mM Potassium Chloride 10 mM Phosphates Does not contain Calcium or Magnesium

  • Ready to use sterile 1x solution Contains: 137 mM Sodium Chloride 2.7 mM Potassium Chloride 10 mM Phosphates Does not contain Calcium or Magnesium

  • Synonym(s): DPBS Application: Dulbecco’s Phosphate Buffered Saline 10X is a stock solution used to prepare 1X D-PBS in cell culture grade water (W3500). D-PBS is used to wash cells during preparation and serial transfer.

  • PBS, 1X Solution, 1.5mL Pre-Filled Tubes

    RPI (Research Products International)

    …in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. Uses include substance dilution and cell container rinsing. Ready to use sterile 1X solution, supplied in sterile pre-filled screw cap tubes. Each tube contains 1.5ml PBS 1X solution, packaged in a…

  • …life QuickSilver™ PBS and PBST Because its osmolality and ion concentration closely mimic that of the human body, PBS is commonly used for cell culture applications, as well as HPLC and MS. PBST is a wash buffer and diluent for ELISA. The 1X PBS solution contains 137mN NaCl, 2.7mM…

  • Phosphate Buffer Saline (PBS)

    Electron Microscopy Sciences

    PBS is commonly used in biochemistry. It is a salty solution containing calcium chloride, sodium phosphate and potassium phosphate. PBS is isotonic and non-toxic to cells. 1X PBS final concentration is 0.137M NaCl, 0.01M Na2HPO4, 0.0027M KCl and pH 7.4.

  • …in the brain. Physical form: Lyophilized from a 0.2 mum filtered solution of 20 mM PB and 250 mM NaCl, pH 7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). This can further be diluted to other aqueous buffers. …

  • …solution [1X] with pH 7.4 Come in convenient ready to use packs with no weighing or adjusting of pH required. These buffer packs have a longer shelf life when compared to the buffer solutions Highly reproducible better compositions Application(s) : Modified Dulbecco's PBS Packs…

  • Ultra pure Phosphate buffered isotonic saline. Without calcium and magnesium. Sterile filtered. 1X PBS solutions contains 137mM NaCl, 2.7mM KCl, 10mM Na2HPO4, 2mM KH2PO4.

  • PBS Tablets

    RPI (Research Products International)

    Phosphate Buffered Saline is a buffer solution commonly used in biological research. PBS has many uses because it is isotonic and non-toxic to most cells. These uses include substance dilution and cell container rinsing. Add one tablet per 100ml of purified water for a 1X solution of PBS.

  • PBS (Phosphate Buffered Saline) Ready-to-use solutions, available in 1X and 10X concentrated solutions. Features 1X: 8mM NaH2PO4,150mM NaCl, 3mM KCl, 2mM KH2PO4(pH 7.4) 10X: 80mM NaH2PO4 1.5M NaCl, 30mM KCl, 20mM…

  • …Carbonate-Bicarbonate buffer, pH 9.4. JAW™ Phosphate Buffered Saline (PBS) packs [1X] make 1L of 2.7mM potassium chloride, 137mM sodium chloride and 10mM phosphate buffer (pH 7.3-7.5). JAW™ Phosphate Buffered Saline (PBS) packs [10X] make 1L of 43mM NaH2PO4,1.37M NaCl,…

  • Synonyms: PBS Other Notes: When diluted to a 1X concentration, this product will yield a phosphate buffered saline solution with a phosphate buffer concentration of 0.01M and a sodium chloride concentration of 0.154M. The solution pH will be 7.4. Packaging: 4L package size comes in a box with…

  • …mum filtered solution of 20 mM PB and 150 mM NaCl, pH7.2. Reconstitution: Dissolve in 1x PBS (It is not recommended to reconstitute to a final concentration less than 100 mug/mL.). After adding 1x PBS, let the tube stand at room temperature for 3 minutes to allow lyophilized protein to dissolve.…

  • PBS (Phosphate Buffered Saline) Ready-to-use solutions, available in 1X and 10X concentrated solutions. Features 1X:  8mM NaH2PO4, 150mM NaCl, 3mM KCl, 2mM KH2PO4 (pH 7.4) 10X: 80mM NaH2PO4 1.5M NaCl,…

  • PBS Blocking Buffer with BSA Premixed Powder is used for immunodetection assays such as Western blots, dot blots and ELISA. 1 pack will make 1 liter of 1X stremgth blocking solution contain 3% BSA.

  • … Synthetic peptide directed towards the N terminal region of human TRIM14 Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Sequence: Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV

  • One tablet dissolved in 100ml of deionized water yields 1 X PBS buffer. The final 1X solution contains: 2.7 mM potassium chloride, 137 mM sodium chloride and 10 mM Phosphate Buffer, pH: 7.3-7.5 at 25°C (1 Tablet in 100ml water).

  • PBS, phosphate buffered saline, is an isotonic solution used in molecular biology, cell culture, protein chemistry, and biochemical applications. PBS is nontoxic to cells and has similar osmolarity and ion concentrations of the human body. Note: pH 7.4 is most commonly used with cell culture. …

  • 1X PBS Buffer with 1% Casein

    Rockland Immunochemicals Inc

    This product is a ready-to-use 1X solution and no further dilution is required.

  • Phosphate Buffered Saline serves as a wash solution in a wide variety of laboratory applications.

  • Phosphate Buffered Saline serves as a wash solution in a wide variety of laboratory applications.

Compare Tool

Select up to 3 products

Please Log In

Don't have a web profile? Create one now.