Primary Polyclonal, Cayman Chemical, 200 µg
-
Caveolin 1/3 Blocking Peptide
Cayman ChemicalPeptide Sequence: rat Cav-3 amino acids 19-41 (CKEIDLVNRDPKNINEDIVKVDF) To be used in conjunction with Cayman’s caveolin 1/3 polyclonal antibody (Catalog No. 100830) to block protein-antibody complex formation during analysis for Cav-1 or -3.
-
Ubiquitin Polyclonal Antibody
Cayman ChemicalAntigen: native bovine ubiquitin conjugated to KLH Host: rabbit Cross Reactivity: (+) human, monkey, mouse, rat, hamster, rabbit, guinea pig, bovine, porcine, canine, pvine, chicken, Xenopus, yeast, Drosophila, and Rainbow Trout ubiquitin Application(s): WB, IP, and ChIP Ubiquitin…
-
Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide
Cayman ChemicalPeptide Sequence: human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE) To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to block protein-antibody complex formation during analysis for hematopoietic type PGD synthase.
-
BLT1 Receptor Blocking Peptide
Cayman ChemicalPeptide Sequence: human amino acids 331-352 (ALEPGPSESLTASSPLKLNELN) To be used in conjunction with Cayman’s BLT1 receptor polyclonal antibodies (Catalog Nos. 100019 and 120114) to block protein-antibody complex formation during analysis for the BLT1 receptor.
-
EP4 Receptor (N-Term) Blocking Peptide
Cayman ChemicalPeptide Sequence: human amino acids 1-23 (MSTPGVNSSASLSPDRLNSPVTI) To be used in conjunction with Cayman’s EP4 receptor polyclonal antiserum (Catalog No. 101770) to block protein-antibody complex formation during analysis for the EP4 receptor.
-
CB2 Receptor Blocking Peptide
Cayman ChemicalPeptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK) To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex formation during analysis for the CB2 receptor. The CB2 receptor is localized…
-
5-Lipoxygenase Blocking Peptide
Cayman ChemicalPeptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN) To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex formation during analysis for 5-LO.
-
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide
Cayman ChemicalPeptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block protein-antibody complex formation during analysis for 15-hydroxy PGDH.
-
COX-2 (human) Blocking Peptide
Cayman ChemicalPeptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE) To be used in conjunction with Cayman’s COX-2 (human) polyclonal antibody (Catalog No. 160107) or the COX-2 (human) monoclonal antibodies (Catalog Nos. 160112, 160113, and 160122) to block…
-
Prostaglandin D Synthase (lipocalin-type) Blocking Peptide
Cayman ChemicalPeptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG) To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block protein-antibody complex formation during analysis for PGD synthase.
-
Nitrotyrosine Affinity Sorbent
Cayman ChemicalThe nitrotyrosine affinity sorbent consists of Cayman’s nitrotyrosine monoclonal antibody conjugated to Sepharose 4B. Application(s): IP and WB The sorbent is designed for immunoprecipitation of nitrated proteins from biological samples. This is an effective way to concentrate nitrated…
-
Prostaglandin I Synthase Blocking Peptide
Cayman ChemicalPeptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT) To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.
-
COX-2 (mouse) Blocking Peptide
Cayman ChemicalPeptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK) To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block protein-antibody complex formation during analysis for COX-2.
-
PAF Receptor Blocking Peptide (Polyclonal)-200 µg
Cayman ChemicalPeptide Sequence: human amino acids 1-17 (MEPHDSSHMDSEFRYTL) To be used in conjunction with Cayman’s PAF receptor polyclonal antiserum (Catalog No. 160602) to block protein-antibody complex formation during analysis for the PAF receptor.
-
COX-1 (ovine) Blocking Peptide
Cayman ChemicalPeptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ) To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation during analysis for COX-1.
-
nNOS Blocking Peptide
Cayman ChemicalPeptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS) To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during analysis for nNOS.
-
eNOS Blocking Peptide
Cayman ChemicalPeptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis for eNOS.
-
CB1 Receptor Blocking Peptide
Cayman ChemicalPeptide Sequence: human, rat, and mouse CB1 receptor sequence amino acids 1-14 (MKSILDGLADTTFR) To be used in conjunction with Cayman’s CB1 receptor polyclonal antibody (Catalog No. 101500) to block protein-antibody complex formation during analysis for the CB1 receptor. The CB1…
-
Prostaglandin Transporter (C-Term) Blocking Peptide
Cayman ChemicalPeptide Sequence: human PGT C-terminal amino acids 627-640 To be used in conjunction with Cayman’s Prostaglandin Transporter (C-Term) Polyclonal Antibody (Item No. 11860) to block protein-antibody complex formation during immunochemical analysis of PGT.
-
sPLA2 (mouse Type V) Blocking Peptide
Cayman ChemicalPeptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex formation during analysis for sPLA2 (type V).
-
PAF Acetylhydrolase Blocking Peptide
Cayman ChemicalPeptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN) To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex formation during analysis for PAF-AH.
-
Caspase-3 (human) Blocking Peptide
Cayman ChemicalPeptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA) To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody complex formation during analysis for caspase-3.