Primary Polyclonal

Compare Tool

Select up to 3 products

1 - 32 of 409
Sort
View
Show
  • Prostaglandin D Synthase (hematopoietic-type; mouse) Polyclonal Antiserum

    Cayman Chemical

    Antigen: recombinant mouse H-PGD synthase Host: rabbit Cross Reactivity: (+) human and mouse H-PGD synthase Applications: IHC and WB Hematopoietic PGD synthase, localized in the antigen-presenting cells, mast cells, and megakaryocytes, catalyzes the isomerization of PGH2 to produce…

  • MBOAT1 Polyclonal Antibody

    Cayman Chemical

    Antigen: human MBOAT1, C-terminal region Host: rabbit Species Reactivity: (+) human Application(s): WB

  • COX-1 (ovine) Polyclonal Antiserum

    Cayman Chemical

    Immunogen: peptide from an internal region of ovine COX-1 Host: rabbit Cross reactivity: (-) ovine, human, and mouse COX-2 Species reactivity: (+) ovine seminal vesicle, human, bovine endothelial, and porcine COX-1 Applications: WB, ICC, IHC

  • CysLT2 Receptor (N-Term) Blocking Peptide

    Cayman Chemical

    Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME) To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block protein-antibody complex formation during analysis for the CysLT2 receptor.

  • Guanylate Cyclase ß1 subunit (soluble) Polyclonal Antibody

    Cayman Chemical

    Antigen: rat soluble guanylate cyclase β1 subunit (soluble) amino acids 188-207 Host: rabbit Cross Reactivity: (+) human, bovine, and rat soluble guanylate cyclase β1 subunit; (−) α1 subunit Application(s): IHC and WB Soluble guanylate cyclase is a heterodimeric…

  • 5-Hydroxymethylcytosine Polyclonal Antibody

    Cayman Chemical

    Protein A-purified IgG Immunogen: human 5-hmC conjugated to KLH Host: rabbit Application(s): Dot blot and ELISA

  • PINK1 Polyclonal Antibody

    Cayman Chemical

    Antigen: human PINK1 amino acids 484-504 Host: rabbit Cross Reactivity: (+) human, mouse, and rat PINK1 Application(s): WB and IHC (paraffin-embedded sections) PINK1 was first identified when studying the tumor-suppressive function of the PTEN signaling pathway and is thus believed to…

  • Synapsin I Polyclonal Antibody (neat serum)

    Cayman Chemical

    Antigen: native protein purified from bovine brain Host: rabbit Cross Reactivity: (+) human, rat, and mouse synapsin I Application(s): WB

  • Goat Anti-Renin (human) Polyclonal Antibody

    Cayman Chemical

    Antigen: recombinant human renin protein Host: goat Cross Reactivity: (+) human Applications: ELISA, IP, and WB

  • PPARo Blocking Peptide

    Cayman Chemical

    Peptide Sequence: human PPAR.delta. amino acids 39-54 To be used in conjunction with Cayman’s PPAR.delta. polyclonal antibody (Catalog No. 101720) to block protein-antibody complex formation during immunochemical analysis of PPAR.delta..

  • sPLA2 (mouse Type V) Polyclonal Antibody

    Cayman Chemical

    Immunogen: synthetic peptide from an internal region of mouse protein Host: rabbit Cross Reactivity: (+) human, mouse, and rat sPLA2 (mouse type V); (−) bee venom and human synovial sPLA2, iPLA2, and cPLA2 Species Reactivity: (+) Human, mouse, and rat sPLA2 Application(s): WB

  • Toll-Like Receptor 1 Polyclonal Antibody

    Cayman Chemical

    Antigen: peptide from human TLR1 within the region of amino acids 400-450 Host: rabbit Cross Reactivity: (+) human, mouse, and rat TLR1 Application(s): FC (intracellular and cell surface) and WB TLR1 interacts with TLR2 and coexpression of TLR1 and TLR2 enhances the NF-kB activation in…

  • PINK1 Blocking Peptide

    Cayman Chemical

    Peptide Sequence: human PINK1 amino acids 484-504 To be used in conjunction with Cayman’s PINK1 polyclonal antibody (Catalog No. 10006283) to block protein-antibody complex formation during analysis for PINK1.

  • Monoacylglycerol Lipase (FL) Polyclonal Antibody

    Cayman Chemical

    Immunogen: Purified recombinant human MAGL Host: rabbit Species Reactivity: (+) human and rat MAGL Applications: IF, IHC, and WB

  • Glutathione S-Transferase Polyclonal FITC Antibody

    Cayman Chemical

    Antigen: purified glutathione S-transferase (S. japonicum) Host: rabbit Cross-Reactivity: (+) GST and GST fusion proteins Application(s): IF and WB; other applications not tested

  • JARID1B/PLU1 (C-Term) Polyclonal Antibody

    Cayman Chemical

    Antigen: human JARID1B/PLU1 amino acids 1,534-1,544 Host: rabbit Cross Reactivity: (+) human JARID1B/PLU1 Application(s): FC and ICC

  • PPARa Polyclonal Antibody

    Cayman Chemical

    Antigen: human, mouse, and rat amino acids 22-36 Host: rabbit Cross Reactivity: (+) human, mouse, rat, ovine, and porcine PPARa; (−) PPARg Application(s): WB PPARa is a ligand-activated transcription factor involved in the regulation of lipid homeostasis.

  • CB1 Receptor (C-Term) Polyclonal Antibody

    Cayman Chemical

    Antigen: human CB1 receptor amino acids 461-472 Host: rabbit Cross Reactivity: (+) human, mouse, and rat CB1 receptor Application(s): IHC (parrafin-embedded tissue) and WB This antibody has been raised against the C-terminal (amino acids 461-472) intracellular region of the human CB1…

  • COX-2 (mouse) Blocking Peptide

    Cayman Chemical

    Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK) To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block protein-antibody complex formation during analysis for COX-2.

  • PAF Receptor Blocking Peptide (Polyclonal)-200 µg

    Cayman Chemical

    Peptide Sequence: human amino acids 1-17 (MEPHDSSHMDSEFRYTL) To be used in conjunction with Cayman’s PAF receptor polyclonal antiserum (Catalog No. 160602) to block protein-antibody complex formation during analysis for the PAF receptor.

  • Prostaglandin D Synthase (hematopoietic-type) Polyclonal Antibody

    Cayman Chemical

    Immunogen: synthetic peptide from the N-terminal region of human H-PGDS Host: rabbit Species Reactivity: (+) human, baboon, mouse, and rat H-PGDS Application(s): WB

  • Tyrosine Hydroxylase Polyclonal Antibody

    Cayman Chemical

    Antigen: SDS-denatured rat tyrosine hydroxylase, purified from pheochromocytoma Host: rabbit Cross-Reactivity: (+) mammalian tyrosine hydroxylase Application: IF, IHC, and WB

  • Fibrinogen (a chain) Polyclonal Antibody

    Cayman Chemical

    Antigen: human Host: rabbit Cross Reactivity: (+) fibrinogen (α chain); (-) fibrinogen (β chain), fibrinogen (γ chain) Species Reactivity: (+) human Application(s): WB

  • Annexin A1 Polyclonal Antibody

    Cayman Chemical

    Immunogen: Full length recombinant annexin A1 protein Host: Rabbit Species Reactivity: (+) Human Annexin A1 Application: ELISA, IP, and WB

  • eIF3G Polyclonal Antibody (aa 200-250)

    Cayman Chemical

    Antigen: portion of amino acids 200-250 of human eIF3G Host: rabbit Cross-reactivity: (+) human, bovine, canine, chimpanzee, equine, mouse, rat, and Rhesus monkey eIF3G Application(s): IHC (paraffin-embedded tissue) and WB

  • LSD1 Polyclonal Antibody (aa 450-500)

    Cayman Chemical

    Antigen: synthetic peptide from human LSD1 amino acids 450-500 Host: rabbit Cross Reactivity: (+) chimpanzee, bovine, canine, equine, human, mouse, orangutan, and porcine LSD1 Application(s): WB LSD1 is a lysine-specific histone demethylase that acts as a component of CoREST and other…

  • NAPE-PLD (Internal) Polyclonal Antibody

    Cayman Chemical

    Immunogen: synthetic Peptide from an internal region of human protein NAPE-PLD Host: rabbit Species Reactivity: (+) human, mouse, and rat NAPE-PLD Application(s): WB NAPE-PLD catalyzes the hydrolysis of NAPE to form NAEs, which are involved in diverse biological processes such as…

  • p38 MAPK (Phospho-Thr180/Tyr182) Polyclonal Antibody

    Cayman Chemical

    Antigen: phosphopeptide corresponding to amino acid residues surrounding phospho-Thr180 and phospho-Tyr182 of rat p38 MAPK Host: rabbit Cross Reactivity: (+) human p38 MAPK Application(s): WB p38 MAPK is activated by both inflammatory cytokines and by stress. It is thought to be…

  • AIF Blocking Peptide

    Cayman Chemical

    Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.

  • JMJD2D Polyclonal Antibody

    Cayman Chemical

    Antigen: human recombinant JMJD2D amino acids 1-354 Host: rabbit Cross Reactivity: (+) human and mouse JMJD2D Application(s): FC, ICC, IP, and WB JMJD2D is a lysine specific demethylase with emerging roles in histone modification or epigenetic remodeling.

  • Prostaglandin Transporter (C-Term) Polyclonal Antibody

    Cayman Chemical

    Antigen: human PGT C-terminal amino acids 627-640 Host: rabbit Cross Reactivity: (+) human, mouse, rat, cow, and sheep PGT; expected to react with canine and chicken PGT Application(s): ICC, IF, and WB Transport of extracellular prostaglandins into cells occurs via a specific PG…

  • IRAK-4 Polyclonal Antibody

    Cayman Chemical

    Antigen: synthetic peptide corresponding to a mixture of mouse IRAK-4 amino acids 38-54 and 120-136 Host: rabbit Cross Reactivity: (+) human and mouse IRAK-4 Application(s): IP and WB IRAK-4 may act as an upstream activator of IRAK-1 and is important for LPS activation of TLRs. Mice…

Compare Tool

Select up to 3 products

Please Log In

Don't have an Account? Create one now.