Chemicals Enzymes and Inhibitors
-
-
Ubiquitin Conjugating Enzyme E2D3 (His6-tagged); Human UBC5
Bio Basic Inc.UBC5, Ubiquitin Conjugating Enzyme E2D3 (His6-tagged), human, UnitProt ID: P61077
-
-
Peroxidase from Horseradish (Amoracia rusticana)
MP BiomedicalsHRP is a plant glycohemoprotein that belongs to the ferroprotoporphyrin group of peroxidases. HRP is composed of seven isozymes. All isozymes contain photohemin IX as prosthetic group. Neutral and amino sugars account for approximately 18% of the enzyme. The iron-containing hemin group is…
-
-
Luciferase (Firefly, Recombinant)
G-BiosciencesFirefly luciferase is a unique photoprotein used in bioluminescence for high sensitive detection and quantification of ATP and as a reporter for studying gene function and regulation.Luciferase (Firefly, Recombinant) is recombinant 62 kDa protein expressed in E. Coli. Click here to request…
-
-
-
-
Proteinase K
Bio Basic Inc.Proteinase K: Activity: >30 units/mg protein (hemoglobin, pH7.5, 37oC) Unit definition: It is the amount of enzyme which releases at 37 oC in 1 min as many folinpositive amino acid and peptides from hemoglobin as 1umol of tyrosine. Features: Proteinase K is a highly active and stable…
-
-
-
-
Phosphatase Inhibitor Cocktail Set I
MilliporeSigmaA cocktail of three inhibitors that will inhibit alkaline phosphatases as well as serine/threonine protein phosphatases such as PP1 and PP2A. This product is provided as a set of five 1 ml vials. Each vial contains 1 ml phosphatase inhibitor cocktail solubilized in DMSO with the following…
-
Collagenase Type 3 from Clostridium histolyticum
MP BiomedicalsCollagenases degrade native helical collagen fibrils. The substrate, collagen, is the major fibrous component of animal extracellular connective tissue: skin, tendon, blood vessels, bone, etc. True collagenase may cleave simultaneously across all three chains or attack a single strand. The enzyme…
-
ß-Glucuronidase Solution from Recombinant E. coli
Soltec Bio ScienceFast rapid complete hydrolysis of glucuronides (30 minutes or less) Clear solution, pure glucuronidase with no sulfatase contaminants Streamlines complete drug screening No conversion of 6-MAM to morphine Quantitative hydrolysis of Carboxy-THC-glucuronide Quantitative analysis of…
-
RPI Isopropyl-B-D-thio-galactopyranoside [IPTG], Non-Mammalian, Dioxane Free
RPI (Research Products International)The RPI non-mammalian isopropyl-B-D-thio-galactopyranoside [IPTG] is suitable for use in research facilities and chemical laboratories to conduct wide range of molecular biology experiments. It is available in sturdy bottle that endures heavy and rigorous usage. This IPTG is dioxane free. …
-
FITC Labeled ß-Amyloid Peptide 1-40
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
-
Antipain
RPI (Research Products International)Reversible cysteine and serine protease inhibitor of cathepsins A and B, papain and trypsin. Working concentration: 1-100uM.
-
-
Pectolyase Y-23 from Aspergillus japonicus
MP BiomedicalsPectolyase Y-23 is a highly purified maceration enzyme from Aspergillus japonicus. It contains two types of pectinase such as endopolygalacturonase and endo-pectin lyase in high activity. Included is a maceration stimulating factor which stimulates tissue maceration by both pectinases. Enzyme…
-
-
Protease Inhibitor Cocktail Set I, Animal-Free
MilliporeSigmaA cocktail of five protease inhibitors for the inhibition of a broad range of proteases and esterases. Each vial, when reconstituted with 1 ml H2O, yields a 100X stock solution. When diluted to 1X the cocktail contains 500 µM AEBSF, HCl, 150 nM Aprotinin, 1 µM E-64, 0.5 mM EDTA,…
-
-
-
-
-
-
-
Protease Inhibitor Cocktail Set IV
MilliporeSigmaA cocktail of four protease inhibitors with broad specificity for the inhibition of aspartic-, cysteine-, metallo-, and serine-proteases. Recommended for fungal and yeast cell extracts. Each vial contains 100 mM AEBSF, HCl, 1.5 mM E-64, 2 mM Pepstatin A, and 500 mM 1,10-Phenanthroline. Supplied…
-