Chemicals Enzymes and Inhibitors
-
-
1, 10-Phenanthroline
RPI (Research Products International)Forms a complex with ferrous ions. It can be used as an indicator in oxidation-reduction systems in fitrating ferrous salts. Material passes test for redox indicator and passes test for iron determination.
-
ß-Amyloid Peptide 1-40
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
-
Elastase from Porcine Pancreas
MP BiomedicalsElastase is an enzyme from the class of proteases (peptidases) that break down proteins. It hydrolyzes peptide bonds, especially those adjacent to neutral amino acids. Hydrolyses elastin Digests hemoglobin, casein, and fibrin One unit will solublize 1 mg of elastin in 20 minutes at…
-
-
-
ß-Glucuronidase Solution from Recombinant E. coli
Soltec Bio ScienceFast rapid complete hydrolysis of glucuronides (30 minutes or less) Clear solution, pure glucuronidase with no sulfatase contaminants Streamlines complete drug screening No conversion of 6-MAM to morphine Quantitative hydrolysis of Carboxy-THC-glucuronide Quantitative analysis of…
-
-
ProteCEASE™
G-BiosciencesProteCEASE™ is a dry format version of our ProteaseARREST™ for large scale preparative applications and for those who prefer reconstitution prior to use. ProteCEASE™ is a superior general protease inhibitor cocktail that is suitable for purification from mammalian, plant,…
-
Collagenase Type IV from Clostridium histolyticum
MP BiomedicalsCollagenases degrade native helical collagen fibrils. It has an important role in connective tissue metabolism and is produced by specific cells involved in repairs and remodelling processes. Collagenase is used for tissue dissociation combined with other enzymes such as elastase, trypsin,…
-
-
-
X-Phos, BCIP
RPI (Research Products International)Colorimetric substrate for Alkaline phosphatase activity in blotting immunohistochemical and cytochemistry techniques. Forms a purple insoluble precipitate when used in conjunction with NBT.
-
RPI Succinyl Chloride
RPI (Research Products International)The RPI succinyl chloride is suitable for use in research facilities and chemical laboratories to conduct wide range of experiments. It is available in sturdy bottle that endures heavy and rigorous usage. Application: Research or Further Manufacturing use only
-
VariSafe™ RNA HIV-1 Gag Gene
VarizymesVarizymes offers a selection of VariSafe RNAs – nuclease-resistant, single-stranded RNAs, suitable as process controls for RNA extraction from various sample matrices. These specially-engineered, non-infectious, MS2 phage-like particles protect their contents from degradation by nucleases and…
-
-
-
ACA
MilliporeSigmaInhibits epinephrine-stimulated thromboxane production (86% at 3.5 μM) via inhibition of phospholipase A2 (PLA2) in human platelets. Also blocks glucose-induced insulin secretion in pancreatic islets. Possesses moderate leukotriene antagonist activity.
-
-
-
Diastase from Malt
MP Biomedicals1X N.F. Stable, 60 mesh powder. 1 gram will digest 50 gram starch in 30 minutes.
-
-
MUP, disodium salt, trihydrate
Bio Basic Inc.The Bio Basic Inc. MUP disodium salt trihydrate is suitable for laboratory and research use.
-
Hyaluronidase from Ovine Testes
MP BiomedicalsHyaluronidase is a glycoprotein containing 5% mannose and 2.17% glucosamine, it catalyzes the random hydrolysis of 1,4-linkages between 2-acetamido- 2-deoxy- β-D-glucose and D-glucose residues in hyaluronate. Hyaluronidase from bovine testes is a tetramer consisting of 4 equal subunits with a…
-
-
-
RNase-Free DNase Set I
Omega Bio-tekThe E.Z.N.A.® RNase-Free DNase I Set is optimized for use with E.Z.N.A.® Total RNA protocols. Normally DNase I digestion is not required for RNA purified with HiBind® RNA Mini Columns as our silica-based spin column technology efficiently removes the majority of DNA without enzymatic…
-
-
flg22 (Flagelin 22)
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: QRLSTGSRINSAKDDAAGLQIA
-
-