Enzymes & Inhibitors

Compare Tool

Select up to 3 products

HomeAll Products

Enzymes & Inhibitors

1 - 32 of 2912
Sort
View
Show

Attention Thomas Scientific Customers

Due to current pandemic, lead times for PPE items are longer than what is listed on our website. Please expect shipping delays of all PPE products during this time.

  • Proteinase K is a highly active serine protease (MW 28,500 Da) isolated from the fungus Tritirachium album. The enzyme exhibits broad cleavage specificity on native and denatured proteins and is widely used in the purification of native RNA and DNA from tissues or cell lines. Because the solution…

  • Caspase-3 Inhibitor I

    MilliporeSigma

  • Proteinase K

    Bioline

    Proteinase K is a highly active serine protease with broad cleavage specificity on native and denatured proteins. Proteinase K is widely used in the purification of native RNA and DNA from tissues or cell lines, as well as for many other applications. Product Highlights High…

  • PMSF

    RPI (Research Products International)

    Irreversible serine protease inhibitor of chymotrypsin, kallikrein, papain, subtilisin, thrombin and trypsin. Working Conentration: 0.1-1.0mM.

  • NAD, Lithium Salt 1GM

    MilliporeSigma

  • Hemoglobin

    MP Biomedicals

    From Beef Blood Autoclavable preparation To be used with GC Agar Base

  • g-Secretase Inhibitor XX

    MilliporeSigma

  • Carbachol

    MilliporeSigma

  • IPTG (Isopropyl ß-D-1-thiogalactopyranoside), is a molecular biology reagent. This compound is a molecular mimic of allolactose, a lactose metabolite that triggers transcription of the lac operon and it is therefore used to induce protein expression where the gene is under the control of the…

  • Tablets provided in glass vials Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a…

  • Acetyl-Pepstatin

    MilliporeSigma

  • A cocktail of five protease inhibitors with broad specificity for the inhibition of cysteine, serine, aspartic, and thermolysin-like proteases and aminopeptidases. This cocktail is recommended for purification of proteins containing His•Tag® sequences. Each vial contains 100 mM AEBSF, HCl…

  • The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

  • Aprotinin Solution 10,000 KIU/mL

    RPI (Research Products International)

    Aprotinin is a competitive serine protease inhibitor that inhibits trypsin, chymotrypsin, kallikrein, and plasmin. Material is provided as a solution containing 10,000 KIU/mL of aprotinin.

  • Nitrocefin

    MilliporeSigma

  • Collagenases degrade native helical collagen fibrils. It has an important role in connective tissue metabolism and is produced by specific cells involved in repairs and remodelling processes. Collagenase is used for tissue dissociation combined with other enzymes such as elastase, trypsin,…

  • Doxorubicin [2mM]

    G-Biosciences

    ((8S,10S)-10-(4-amino-5-hydroxy-6-methyl-tetrahydro-2H-pyran-2-yloxy)-6,8,11-trihydroxy-8-(2-hydroxyacetyl)-1-methoxy-7,8,9,10-tetrahydrotetracene-5,12-dione) Doxorubicin (or hydroxyldaunorubicin) is an anthracycline antibiotic that intercalates DNA, inhibiting the unwinding of DNA by…

  • 14-3-3 Antagonist I

    MilliporeSigma

  • Lysozyme

    Bio Basic Inc.

    Lysozyme is a single chain polypeptide of 129 amino acids cross-linked with four disulfide bridges. It hydrolyzes ß(1→4) linkages between N-acetylmuraminic acid and N-acetyl-D-glucosamine residues in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrin. The enzyme is…

  • Akt Activator II

    MilliporeSigma

  • Proteinase K

    Bio Basic Inc.

    Proteinase K is a highly active and stable protease with low cutting specificity. The enzyme belongs to the group of subtilisine-related serine proteases and is strongly inhibited by PMSF.

  • Storage: -20C UNSPSC Code: 41105600 General description: IsoschizomersThe enzyme has no known isoschizomers.Methylation sensitivityEco47 III is inhibited by the presence of 5-methylcytosine at the indicated site (*) on the recognition sequence. The presence of 6-methyladenine () does not…

  • Proteinase K Solution

    Omega Bio-tek

    Useful for the inactivation of nucleases and lysis during the isolation of DNA and RNA.

  • PIM1/2 Kinase Inhibitor V

    MilliporeSigma

  • Lovastatin (Mevinolin)

    MilliporeSigma

Compare Tool

Select up to 3 products

Please Log In

Don't have a web profile? Create one now.