• PRODUCT AVAILABILITY: Did you know you can view a product's availability right on the product page? Simply enter the quantity you want to purchase and the current availability will appear below the item.

  • Product C746M25 is restricted and can only be purchased by customers with a web profile linked to a Thomas Business Account - Click here to login or create your web profile. If you do not have a Thomas Business Account, please Contact Us and someone will respond with details on how to apply for a business account with us.

Boster Bio

Anti-TNF alpha Picoband™ Antibody

Not yet rated

NOTE: Due to special handling or shipping requirements, these products will have additional fees added during checkout. Click HERE for a description of what fees might be charged.

Polyclonal antibody for TNF ALPHA/Tnf detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Mouse. TNF ALPHA/Tnf information: Molecular Weight: 25896 MW; Subcellular Localization: Cell membrane; Single-pass type II membrane protein.

Background:
TNFalpha(Tumor Necrosis Factor alpha) gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. And this cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. Moreover, this cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.

Attributes:
sku: A00002-2
name: Anti-TNF alpha Picoband™ Antibody
gene_name: Tnf
clonality: Polyclonal
concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
size: 100ug/vial
uniprot_id: P06804
host: Rabbit
immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse TNF alpha (202-235aa FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL), different from the related human sequence by five amino acids, and from the related rat sequence by three amino acids.
form: Lyophilized
purification: Immunogen affinity purified.
storage: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
cross_reactivity: No cross reactivity with other proteins.
isotype: N/A
reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application_details: Western blot, 0.1-0.5μg/ml, Mouse

applications: WB
reactivity: Mouse
research_category: Atherosclerosis, Cancer, Cardiovascular, Cytokines, Growth Factors, Growth Factors/Hormones, Immunology, Innate Immunity, Metabolism, Signal Transduction, Tnf Superfamily, Vascular Inflammation
synonyms: Tumor necrosis factor;Cachectin;TNF-alpha;Tumor necrosis factor ligand superfamily member 2;TNF-a;Tumor necrosis factor, membrane form;N-terminal fragment;NTF;Intracellular domain 1;ICD1;Intracellular domain 2;ICD2;C-domain 1;C-domain 2;Tumor necrosis factor, soluble form;Tnf;Tnfa, Tnfsf2;
gene_full_name: Tumor necrosis factor
molecular_weight: 25896 MW
protein_function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
subcellular_localization: Cell membrane; Single-pass type II membrane protein.
protein_name: Tumor necrosis factor
recommended_detection_systems: Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Please Enter Your Order Info

Filter by:

  • Clear Filters
Product Detail
Thomas No.
C746M25
Mfr. No.
A00002-2
Pkg. Size
100 ug/vial
Description
Anti-TNF alpha Picoband™ Antibody, 100ug/vial
Pkg. Type
Vial
list price/quantitytotal
$0.00
$0.00 (0 Items)
Product C746M25 is restricted and can only be purchased by customers with a web profile linked to a Thomas Business Account - Click here to login or create your web profile. If you do not have a Thomas Business Account, please Contact Us and someone will respond with details on how to apply for a business account with us.

Write A Review