Chemicals Enzymes and Inhibitors
-
-
Collagenase Type IV from Clostridium histolyticum
MP BiomedicalsCollagenases degrade native helical collagen fibrils. It has an important role in connective tissue metabolism and is produced by specific cells involved in repairs and remodelling processes. Collagenase is used for tissue dissociation combined with other enzymes such as elastase, trypsin,…
-
-
ProteaseArrest™ for Plant
G-BiosciencesA broad range, 100X concentrated, ready-to-use protease inhibitor cocktail. Plant ProteaseArrest™ inhibits plant serine, cysteine and other plant specific proteases including aminopeptidases, aspartic and metalloproteases. ProteaseArrest Family Our ProteaseArrest™ is a…
-
Protease Inhibitor Cocktail Set VI
MilliporeSigmaA cocktail of six protease inhibitors with broad specificity for the inhibition of aspartic, cysteine, serine, and metalloproteases as well as aminopeptidases. This cocktail is recommended for use with plant cell extracts. Each vial contains 200 mM AEBSF, HCl, 0 mM Bestatin, 3 mM E-64, 2 mM…
-
-
-
-
Peroxidase from Horseradish (Amoracia rusticana)
MP BiomedicalsHRP is a plant glycohemoprotein that belongs to the ferroprotoporphyrin group of peroxidases. HRP is composed of seven isozymes. All isozymes contain photohemin IX as prosthetic group. Neutral and amino sugars account for approximately 18% of the enzyme. The iron-containing hemin group is…
-
ß-Amyloid (1-42), Rat
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
3 x Flag-tag
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: MDYKDHDGDYKDHDIDYKDDDDK
-
Liberase TL Research Grade contains highly purified Collagenase I and Collagenase II. These two collagenase isoforms are blended in a precise ratio to each other and with a low concentration of Thermolysin, a non-clostridial neutral protease. Maximize viability and yield of isolated cells…
-
-
ArcticZymes R2D Ligase™
ArcticZymesArcticZymes RNA to DNA Ligase (ArcticZymes R2D LigaseTM) is the first ligase on the market that is able to ligate DNA to 5’-phosphorylated ends of RNA in the presence of a DNA template positioning the joinable ends. With its unique substrate specificity, ArcticZymes R2D Ligase allows the…
-
Roche PhosSTOP™
MilliporeSigmaFeatures and Benefits Achieve immediate, effective, and convenient inhibition of a broad spectrum of phosphatases across a wide range of sample materials (e.g., mammalian, plant, yeast, and bacteria) with non-toxic PhosSTOP Phosphatase Inhibitor Cocktail Tablets. PhosSTOP is a proprietary blend…
-
-
Trypsin (Porcine), Mass Spectrometry Grade
G-BiosciencesA Chemically Modified, TPCK treated, Affinity Purified Trypsin Trypsin is a serine endopeptidase that specifically cleaves peptide bonds on the carboxy side of s-aminoethyl cysteine, arginine and lysine residues, and typically, there is little to no cleavage at arginyl-proline and lysyl-proline…
-
-
-
-
SAN HQ Triton FREE
ArcticZymesSAN High Quality - Bioprocessing grade - Triton FREE S AN High Quality is the ultimate solution for efficient removal of nucleic acids in high-salt manufacturing and bioprocessing workflows. This nonspecific endonuclease has optimum activity at salt…
-
ApopTag® Peroxidase
MP BiomedicalsApopTag® Peroxidase in situ detection kits label apoptotic cells in research samples by modifying DNA fragments utilizing terminal deoxynucleotidyl transferase (TdT) for detection of apoptotic cells by immuno-peroxidase detection of digoxigenin-labeled genomic DNA in thin sections of fixed…
-
-
ONPG
RPI (Research Products International)Colorimetric and spectrophotometric substrate for detection of β-D-Galactosidase.
-
-
Collagenase Type II from Clostridium histolyticum
MP BiomedicalsCollagenases degrade native helical collagen fibrils. Plays an important role in connective tissue metabolism Produced by specific cells involved in repairs and remodeling processes Type II enzyme that contains greater clostripain activity Collagenase is used for collagen…
-
-
IsoPol® BST+
ArcticZymesIsoPol® BST+ is a heat-tolerant Bst polymerase (large fragment) with enhanced strand-displacement activity. IsoPol® BST+ is active from 25 to 65°C. It is lacking 5’-3’- and 3’-5’-exonuclease activity. Properties Unit Definition: One unit is defined as…
-
-
X-GlcA Cyclohexylammonium Salt
RPI (Research Products International)Histochemical substrate for β-D-Glucuronidase (GUS) encoded by the gusA gene. The substrate is used as a qualitative histochemical marker of specific GUS expression in cells and tissue. X-GlcA is cleaved by GUS at the B1 glucuronic bond between glucuronic acid and the…
-
Indoxyl-Gal (Indoxyl-b-D-galactopyranoside)
Bio Basic Inc.The Bio Basic Inc. indoxyl-gal (indoxyl-b-D-galactopyranoside) is suitable for laboratory and research use. Application: For Laboratory Research Only
-
Trypsin from Beef Pancreas
MP BiomedicalsTrypsin consists of a single chain polypeptide of 223 amino acid residues. Member of the serine protease family Dissolves blood clots in its microbial form Treats inflammation in its pancreatic form Trypsin cleaves peptides on the C-terminal side of lysine and arginine residues.…