Purified from chicken egg white, 2x crystallized, dialyzed and supplied as a salt free lyophilized powder. Stable for 3 - 5 years when stored dry at 2°C to 8°C.

Chromogenic substrate for B-D-Galactosidase. Produces a deeper blue water insoluble color than X-GAL.

β-Galactosidase is useful for the structural investigation of carbohydrate, the determination of lactose (foodstuff analysis) and as an enzyme label for enzyme immunoassay. β-Galactosidase cleaves terminal galactose residues, which are β -1-->14 linked to a monosaccharide,…

Mixture of four protease inhibitors for use with fungal and yeast extracts. Supplied in 1 ml DMSO. Will inhibit proteases extracted from 20g yeast. Contains: AEBSF Pepstatin A E-64 Phenanthroline Specificity: Serine Protease Cysteine Proteases Aspartic …

Cellulase refers to a group of enzymes which, acting together, hydrolyze cellulose. The b-glucosidases, including cellobiose, are primarily active on the smaller molecular weight cellulose hydrolysates. During cellulose breakdown they are active on the dimers and oligomers of cellulose. …

Fluorescent substrate for α-D-Galactosidase.

Extracted from yeast. Coenzyme A is a coenzyme, notable for its role in the synthesis and oxidation of fatty acids, and the oxidation of pyuvate in the citric acid cycle.

Collagenases degrade native helical collagen fibrils. Plays an important role in connective tissue metabolism Produced by specific cells involved in repairs and remodeling processes Type II enzyme that contains greater clostripain activity Collagenase is used for collagen…

Firefly luciferase is a unique photoprotein used in bioluminescence for high sensitive detection and quantification of ATP and as a reporter for studying gene function and regulation.Luciferase (Firefly, Recombinant) is recombinant 62 kDa protein expressed in E. Coli. Click here to request…

Acetyl-CoA is produced via beta-oxidation of fatty acids, via the metabolism of carbohydrates - glucose 6-phosphate to pyruvate to acetyl-CoA and via the catabolism of amino acids. Acetyl-CoA has a number of metabolic opportunities. It is metabolized in the tricarboxylic acid cycle to produce…

Tn5 transposase (Tnp) is a hyperactive retroviral integrase that is used to construct random next-generation sequencing libraries and to study chromatin structure using targeted ATAC-seq. Tn5 transposase can be used to randomly fragment any target DNA and insert unique oligonucleotide adapters in a…

IPTG is combined with X-GAL to detect lac+ colonies or cells in a colorimetric assay. Distinguishes recombinants (white) from non- recombinants (blue) in cloning strategies using vectors such as Lambda-11, M13mp 18 and 19, pUC18 and 19, pUR222 containing the lacZ gene. Dioxane-Free Water…

Features and Benefits Achieve immediate, effective, and convenient inhibition of a broad spectrum of phosphatases across a wide range of sample materials (e.g., mammalian, plant, yeast, and bacteria) with non-toxic PhosSTOP Phosphatase Inhibitor Cocktail Tablets. PhosSTOP is a proprietary blend…

Elastase is an enzyme from the class of proteases (peptidases) that break down proteins. It hydrolyzes peptide bonds, especially those adjacent to neutral amino acids. Hydrolyses elastin Digests hemoglobin, casein, and fibrin One unit will solublize 1 mg of elastin in 20 minutes at…

DirecTaq DNA polymerase 1X Master Mix saves time and cost by enabling direct PCR amplification of unpurified templates. It contains a recombinant, truncated (lacks 5’ to 3’ exonuclease activity), highly thermostable DNA polymerase from the thermophilic bacterium Thermus aquaticus. The…

Fluorescent substrate for Esterase. Purity: > 98%. 4-Methylumbelliferone < 50ppm. Soluble in 5% toluene.

The RPI methyl-a-D-mannopyranoside with strong concentration levels should always be stored in a temperature of 2 to 8 degree C and is used in research and manufacturing applications. Application: For Research or Further Manufacturing use only

M-SAN HQ (Bioprocessing Grade) is the recent addition to our high salt tolerance nucleases portfolio. The biochemical properties of the SAN family of nucleases make them ideal for multiple bioprocessing and biomanufacturing workflows. M-SAN HQ has been developed to offer the optimal solution for…

The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Lyophilized blend of five inhibitors for inhibiting a broad range of proteasesand esterases. Reconstitutes with 1 ml of water to produce a 100X concentrate solution. Contains: AEBSF E-64 Leupeptin Aprotinin EDTA Specificity: Serine Proteases Esterases …

A serine peptidase that cleaves at internal peptide bonds on the carboxyl-side of arginine and lysine residues. USP Grade Activity (min.) at 25 C >2,500U/mg Chymotrypsin 5.0% Unit Definition: The amount of enzyme which causes an increase in absorbance of 0.003 per minute at 25 C…