Enzymes & Inhibitors

Compare Tool

Select up to 3 products

HomeAll Products

Enzymes & Inhibitors

1 - 32 of 3026
Sort
View
Show
  • Proteinase K 20 mg/ml Solution

    Amresco

    Grade: Biotechnology

  • Proteinase K

    Amresco

    Grade: Biotechnology A non-specific serine protease (MW~18,000 Da) that exhibits high activity in the presence of SDS, EDTA and Urea as well as over a wide pH range. Shelf life: 36 months

  • Proteinase K

    Bio Basic Inc.

    Proteinase K is a highly active and stable protease with low cutting specificity. The enzyme belongs to the group of subtilisine-related serine proteases and is strongly inhibited by PMSF.

  • Glucose oxidase

    bioWORLD

    Molecular Biology Grade Specific activity (25° C): ≥95U/mg Solubility (1%, water): Clear and haze-free Glucose Oxidase: Catalase ratio >100:1 Unit Definition: The amount of enzyme which causes the oxidation of 1 micromole of glucose per minute at 25 C, pH 7.0 50 ku

  • Trypsin 1:300

    Bio Basic Inc.

  • Calbiochem® Fumonisin B1, Fusarium moniliforme

    MilliporeSigma

    A cell-permeable mycotoxin that inhibits sphingolipid biosynthesis in rat kidney and in liver microsomes by inhibition of sphingosine N-acyltransferase (ceramide synthase; IC50 = 100 nM). CAS number: 116355-83-0

  • Nystatin, Streptomyces noursei

    MilliporeSigma

  • T4 DNA ligase

    bioWORLD

    T4 DNA Ligase catalyzes the forming of a phosphodiester bond between juxtaposed 5'-phosphate and 3'-hydroxyl termini in duplex DNA or RNA with blunt or cohesive-end termini. This ligase repairs single-stranded nicks in duplex DNA, RNA or DNA/RNA hybrids but has no activity on…

  • Proteinase K, Tritirachium album

    MilliporeSigma

  • Zymolyase

    bioWORLD

    Yeast lytic enzyme

  • Catalase from Beef Liver

    MP Biomedicals

    Catalase is an oxidoreductase that catalyzes the conversion of hydrogen peroxide to water and oxygen. Activates the decomposition of hydrogen peroxide Natural antioxidant Used to study roles of reactive oxygen species in gene expression and apoptosis Hydrogen peroxide is a harmful…

  • Pepsin from Porcine Stomach Mucosa

    MP Biomedicals

    Pepsin, an acid protease, contains a proteolytic enzyme. Pepsin contains the "cathepsin" component which has milk curdling activity. It has a broad range of substrate activity and demonstrates an esterase acitivity. It generally attacks peptide bonds. Pepsin is a peptidase used to…

  • Trypsin 0.05%-EDTA 0.1%

    Quality Biological

    Trypsin is a proteolytic enzyme used to detach adherent cell from culture vessel surfaces. Typical use includes removing adherent cells from a culture surface. The concentration of trypsin necessary to dislodge cells from their substrate is dependent primarily on the cell type and the age of the…

  • Trypsin from Porcine

    MP Biomedicals

    The typical use for this product is in removing adherent cells from a culture surface. The concentration of trypsin necessary to dislodge cells from their substrate is dependent primarily on the cell type and the age of the culture. Trypsins have also been used for the re-suspension of cells during…

  • Cellulase (Onozuka R-10)

    bioWORLD

    From Trichadema Viride. Enzyme mixture often used in combination with Macerozyme R-10 (M22010) for isolation of plant protoplasts. One unit of Cellulase will liberate 1.0 µmole of glucose from carboxymethyl cellulose. Lyophilized powder Optimum pH range: 4-5

  • Peroxidase Horseradish (HRP)

    Amresco

    Grade: Conjugation

  • PIP3 Antagonist II, DM-PIT-1

    MilliporeSigma

  • FITC Labeled ß-Amyloid Peptide 1-40

    EZBiolab

    The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: FITC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

  • Calpastatin, Human, Recombinant, Domain I

    MilliporeSigma

  • ATRA-BA Hybrid

    MilliporeSigma

  • Kisspeptin 10

    EZBiolab

    The purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: YNWNSFGLRF-NH2

  • Lysozyme

    Bio Basic Inc.

    Lysozyme is a single chain polypeptide of 129 amino acids cross-linked with four disulfide bridges. It hydrolyzes ß(1→4) linkages between N-acetylmuraminic acid and N-acetyl-D-glucosamine residues in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrin. The enzyme is…

  • Trypsin (bovine)

    bioWORLD

    A serine peptidase that cleaves at internal peptide bonds on the carboxyl-side of arginine and lysine residues. USP Grade Activity (min.) at 25 C >2,500U/mg Chymotrypsin 5.0% Unit Definition: The amount of enzyme which causes an increase in absorbance of 0.003 per minute at 25 C…

  • BCIP

    bioWORLD

    Also known as 5-Bromo-4-Chloro-3-Indolyl Phosphate. A widely used chromogenic substrate for alkaline phosphatase in enzyme-linked assay systems. BCIP may be used alone, or may act in a coupled reaction with NBT. Upon cleavage of the phosphate group from the molecule, BCIP forms a bright blue,…

  • Hydroxylamine Hydrochloride

    MP Biomedicals

    MAO inhibitor; inhibits platelet aggregation.

  • Calbiochem® Fumonisin B2, Fusarium moniliforme

    MilliporeSigma

    Structural analog of Fumonisin B1 that has higher cytotoxicity and specific binding to primary rat hepatocytes than fumonisin B1. CAS: 116355-84-1

  • Etomoxir

    MilliporeSigma

  • Creatine Amidohydrolase from Pseudomonas sp.

    MP Biomedicals

    This enzyme is useful for enzymatic determination of creatinine when coupled with creatine amidinohydrolase, sarcosine dehydrogenase or sarcosine oxidase and formaldehyde dehydrogenase in clinical analysis. Creatininase from Pseudomonas sp. is a homohexameric enzyme with a molecular mass of 28.4…

  • Lactacystin, Synthetic

    MilliporeSigma

  • APE1 Inhibitor III

    MilliporeSigma

  • VEGFR Tyrosine Kinase Inhibitor V

    MilliporeSigma

  • 4-Methylumbelliferyl-B-D-glucopyranoside Monohydrate

    RPI (Research Products International)

    Fluorescent substrate for B-D-Glucosidase.

Compare Tool

Select up to 3 products

Please Log In

Don't have an Account? Create one now.