Chemicals Enzymes and Inhibitors
-
-
-
Choline Oxidase from Alcaligenes sp.
MP BiomedicalsCholine oxidase (EC 1.1.3.17) is an enzyme that catalyzes the chemical reaction Choline + O2 betaine aldehyde + H2O2. Thus, the two substrates of this enzyme are choline and O2, whereas its two products are betaine aldehyde and H2O2. This enzyme belongs to the family of oxidoreductases,…
-
MetaPolyzyme, lyophilized powder
MilliporeSigmaSynonyms: Multilytic Enzyme Mix Storage: -20C UNSPSC Code: 12352200 General description: Metagenomics analysis looks at all DNA that has been isolated directly from given single samples (e.g. environmental samples, biological organisms). Metagenomics allows for the investigation of…
-
X-Phos, BCIP
RPI (Research Products International)Colorimetric substrate for Alkaline phosphatase activity in blotting immunohistochemical and cytochemistry techniques. Forms a purple insoluble precipitate when used in conjunction with NBT.
-
M-SAN HQ ELISA Kit
ArcticZymesArcticZymes offers M-SAN HQ ELISA Kit to confirm the removal of M-SAN High Quality (Bioprocessing Grade) in bioprocessing and biomanufacturing applications. Key features: Fast: 1.5 – 2 hours Sensitive: Quantification range: 0.12 – 7.5 ng/ml Accurate: 100%…
-
Roche cOmplete™, EDTA-free Protease Inhibitor Cocktail
MilliporeSigmaTablets provided in glass vials Use cOmplete Protease Inhibitor Tablets to protect your proteins from a wide range of proteases. In just minutes, uninhibited proteolytic activity can degrade the protein you have spent days isolating. Each of these convenient water-soluble tablets contains a…
-
-
PHORBOL 12-MYRISTATE 13-ACETATE, 25 mg
MP BiomedicalsPMA activates Ca2+- ATPase and potentiates forskolin-induced cAMP formation. It has been shown to inhibit apoptosis induced by the Fas antigen, but PMA induces apoptosis in HL-60 promyelocytic leukemia cells.
-
Synonym: Donor:hydrogen-peroxide oxidoreductase, Horseradish peroxidase CAS Number: 9003-99-0 EC Number: 232-668-6 Enzyme Commission (EC) Number: 1.11.1.7 MDL number: MFCD00071339 Analysis Note The RZ (Reinheitszahl) is the absorbance ratio…
-
elf18
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: Ac-SKEKFERTKPHVNVGTIG
-
Varizymes offers a selection of VariSafe RNAs – nuclease-resistant, single-stranded RNAs, suitable as process controls for RNA extraction from various sample matrices. These specially-engineered, non-infectious, MS2 phage-like particles protect their contents from degradation by nucleases and…
-
-
Proteinase K
Bio Basic Inc.Proteinase K: Activity: >30 units/mg protein (hemoglobin, pH7.5, 37oC) Unit definition: It is the amount of enzyme which releases at 37 oC in 1 min as many folinpositive amino acid and peptides from hemoglobin as 1umol of tyrosine. Features: Proteinase K is a highly active and stable…
-
-
-
-
Catalase from Bovine Liver
MP BiomedicalsCatalase from bovine liver is a homotetrameric enzyme that is primarily located in peroxisomes. Activates the decomposition of hydrogen peroxide Natural antioxidant used to study roles of reactive oxygen species Catalyzes the decomposition of hydrogen peroxide into water and oxygen …
-
4-Methylumbelliferyl-α-D-galactoside
RPI (Research Products International)Fluorescent substrate for α-D-Galactosidase.
-
Phosphoglucose Isomerase from Baker's Yeast
MP BiomedicalsPhosphoglucose Isomerase(PGI) is an enzyme crucial for the interconversion of D-glucose 6 phosphate and D-fructose 6-phosphate. Responsible for the second step of glycolysis Involved in glucogenesis Highly conserved in bacteria and eukaryotes Phosphoglucose Isomerase fuctions as an…
-
-
-
Resveratrol
MP BiomedicalsPotent phenolic antioxidant found in grapes and red wine. Eicosanoid synthesis and platelet aggregation inhibitor. Estrogen receptor agonist. Chemopreventive. Specific inhibitor of cyclooxygenase-1 (COX-1). Anti-inflammatory. Ribonucleotide reductase and DNA synthesis. Arrests cell cycle at S/G2…
-
-
-
M-SAN HQ (Bioprocessing Grade) is the recent addition to our high salt tolerance nucleases portfolio. The biochemical properties of the SAN family of nucleases make them ideal for multiple bioprocessing and biomanufacturing workflows. M-SAN HQ has been developed to offer the optimal solution…
-
-
ß-Amyloid Peptide 1-40
EZBiolabThe purity of every peptide is > 95% or higher , determined by HPLC A product report including Mass and HPLC spectra of each peptide is included in shipping All peptides are shipped in lyophilized powder Quality is guaranteed Seq: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
Varizymes offers a selection of VariSafe RNAs – nuclease-resistant, single-stranded RNAs, suitable as process controls for RNA extraction from various sample matrices. These specially-engineered, non-infectious, MS2 phage-like particles protect their contents from degradation by nucleases and…
-
X-GAL
RPI (Research Products International)Chromogenic substrate of β-Galactosidase used in combination with IPTG for detection of β-Galactosidase activity in bacterial colonies. X-GAL is cleaved at the B1-4 bond between galactose and the 5-Bromo-4-chloro-3-indolyl portion of X-GAL by β-Galactosidase via hydrolysis. The…
-