PRODUCT AVAILABILITY: Did you know you can view a product's availability right on the product page? Simply enter the quantity you want to purchase and the current availability will appear below the item.
Not yet rated
NOTE: Due to special handling or shipping requirements, these products will have additional fees added during checkout. Click HERE for a description of what fees might be charged.
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW)
To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.