• PRODUCT AVAILABILITY: Did you know you can view a product's availability right on the product page? Simply enter the quantity you want to purchase and the current availability will appear below the item.

  • Product C790Q15 is restricted and can only be purchased by customers with a web profile linked to a Thomas Business Account - Click here to login or create your web profile. If you do not have a Thomas Business Account, please Contact Us and someone will respond with details on how to apply for a business account with us.

Cayman Chemical

AIF Blocking Peptide

Not yet rated

NOTE: Due to special handling or shipping requirements, these products will have additional fees added during checkout. Click HERE for a description of what fees might be charged.

Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW)

To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.

Please Enter Your Order Info

Filter by:

  • Clear Filters
Product Detail
Thomas No.
C790Q15
Mfr. No.
360773-1
Description
AIF Blocking Peptide
Packaging Size
1 each
Packaging Type
Tube, Plastic
list price/quantitytotal
$0.00
$0.00 (0 Items)
Product C790Q15 is restricted and can only be purchased by customers with a web profile linked to a Thomas Business Account - Click here to login or create your web profile. If you do not have a Thomas Business Account, please Contact Us and someone will respond with details on how to apply for a business account with us.

Write A Review